Germany
Japan
United Kingdom
China
Antibodies
Download
Goat Polyclonal Anti-HIF1a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli. |
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit anti-PGF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGF |
Rabbit polyclonal HIF1A Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Goat Polyclonal Anti-HIF1a Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 470 to 590 aa of human HIF1a produced in E. coli. |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-Elongin C Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant full-length |
Rabbit Polyclonal Anti-EGLN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGLN2 antibody: synthetic peptide directed towards the N terminal of human EGLN2. Synthetic peptide located within the following region: MCLPSPSKPTSLHPCQAMVACYPGNGLGYVRHVDNPHGDGRCITCIYYLN |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
| Applications | ELISA, FN, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Pathways
- Renal cell carcinoma
Filter by
Target Symbol
- MAP2K1 (237)
- JUN (183)
- AKT1 (127)
- BRAF (100)
- MAPK1 (74)
- MET (64)
- PIK3CG (64)
- KRAS (58)
- VEGFA (53)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- ARNT (37)
- PIK3CD (35)
- PTPN11 (35)
- MAP2K2 (34)
- RAF1 (33)
- HGF (31)
- HIF1A (29)
- PAK1 (26)
- PIK3CA (25)
- ARAF (24)
- FH (24)
- RAPGEF1 (24)
- VEGFB (24)
- VEGFD (24)
- MAPK3 (23)
- EPAS1 (22)
- PAK4 (22)
- TGFB1 (22)
- AKT3 (19)
- NRAS (17)
- EGLN2 (16)
- PDGFB (16)
- PIK3R1 (14)
- EP300 (12)
- VHL (12)
- GRB2 (11)
- VEGFC (10)
- EGLN1 (9)
- PGF (9)
- CRK (8)
- GAB1 (8)
- PAK2 (8)
- TGFB2 (8)
- CREBBP (7)
- CRKL (7)
- CUL2 (7)
- EGLN3 (7)
- PAK5 (7)
- SLC2A1 (7)
- ETS1 (6)
- RAC1 (6)
- RAP1A (6)
- TGFA (6)
- CDC42 (5)
- FLCN (5)
- PAK3 (5)
- TGFB3 (5)
- ARNT2 (4)
- ELOC (4)
- PIK3CB (4)
- PIK3R3 (4)
- RAP1B (4)
- PAK6 (3)
- SOS2 (3)
- B RAF (2)
- ELOB (2)
- PIK3R2 (2)
- RBX1 (2)
- SOS1 (2)
- P38 (1)
- PAK7 (1)
- TCEB1 (1)
- TCEB2 (1)
Reactivities
- Human (1726)
- Mouse (1542)
- Rat (1483)
- Dog (389)
- Monkey (344)
- Bovine (30)
- Chicken (17)
- Pig (12)
- Xenopus (10)
- Cow (9)
- Canine (8)
- Primate (7)
- Rabbit (7)
- Hamster (6)
- Porcine (5)
- Sheep (5)
- Drosophila (4)
- Ferret (3)
- Guinea Pig (3)
- Canis (2)
- Rhesus Monkey (2)
- X. tropicalis (2)
- C. elegans (1)
- Chimpanzee (1)
- Fish (1)
- Goat (1)
- Horse (1)
- Zebrafish (1)