Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PNPLA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS |
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Anti-ADH5 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-DDC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
Goat Polyclonal Antibody against GOT1 (Internal region)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSYRYWDAEKR, from the internal region of the protein sequence according to NP_002070.1. |
Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV |
Rabbit Anti-DOPA Decarboxylase, Human Antibody
| Applications | WB |
| Reactivities | Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH |
Rabbit polyclonal GOT2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GOT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-61 amino acids from the N-terminal region of human GOT2. |
Rabbit anti-PNMT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PNMT |
Rabbit Polyclonal Anti-ADH1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA |
Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709) |
Rabbit Polyclonal Anti-ADH1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1A antibody: synthetic peptide directed towards the N terminal of human ADH1A. Synthetic peptide located within the following region: NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA |
Goat Anti-Tyrosine Hydroxylase Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VQDELDTLAHAL, from the C Terminus of the protein sequence according to NP_954986.2; NP_000351.2; NP_954987.2. |
Rabbit Anti-Tyrosine Hydroxylase Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | SDS-denatured, native rat tyrosine hydroxylase purified from pheochromocytoma |
Rabbit polyclonal Tyrosine Hydroxylase (Ab-19) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q). |
Rabbit polyclonal Tyrosine Hydroxylase (Ser19)(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q). |
| Modifications | Phospho-specific |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Anti-COMT Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%). |
Rabbit polyclonal ADH1B Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit polyclonal ADH7 Antibody (C-Term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-346 amino acids from the C-terminal region of human ADH7. |
Rabbit anti-MIF Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MIF |
DBH Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human DBH |
Rabbit Polyclonal Anti-TYRP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
Rabbit Polyclonal Anti-DDC Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC. Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL |
Rabbit Polyclonal Anti-HPD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HPD antibody: synthetic peptide directed towards the middle region of human HPD. Synthetic peptide located within the following region: EMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWSVDDTQVHTEYSSLRSIV |
Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the N terminal of human ADH1B. Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD |
Rabbit Polyclonal Anti-ADH6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH6 antibody: synthetic peptide directed towards the middle region of human ADH6. Synthetic peptide located within the following region: AGAARIIGVDVNKEKFKKAQELGATECLNPQDLKKPIQEVLFDMTDAGID |
Rabbit Polyclonal Anti-TRMT11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11. Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP |
Rabbit Polyclonal Anti-ARD1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARD1A antibody: synthetic peptide directed towards the middle region of human ARD1A. Synthetic peptide located within the following region: VESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSE |
Rabbit Polyclonal Anti-NAT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NAT6 antibody: synthetic peptide directed towards the C terminal of human NAT6. Synthetic peptide located within the following region: GYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGP |
Rabbit Polyclonal Anti-LCMT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS |
Rabbit Polyclonal Anti-METTL2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE |
Rabbit Polyclonal Anti-METTL2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS |
Active filters
Reactivities
- Human
Pathways
- Tyrosine metabolism
Filter by
Category
Target Symbol
- PNMT (87)
- TH (50)
- LCMT1 (45)
- ADH1B (35)
- ADH5 (29)
- ALDH1A3 (20)
- ADH7 (17)
- ALDH3A1 (16)
- TYR (14)
- MAOA (13)
- ALDH3B1 (11)
- GSTZ1 (11)
- GOT2 (8)
- GOT1 (7)
- TAT (7)
- DBH (6)
- PNPLA3 (6)
- TPO (6)
- ADH1A (5)
- ADH4 (5)
- AOX1 (5)
- BUD23 (5)
- DDC (5)
- MAOB (5)
- COMT (4)
- MIF (4)
- DCT (3)
- FAH (3)
- ALDH3B2 (2)
- AOC2 (2)
- AOC3 (2)
- IL4I1 (2)
- LCMT2 (2)
- METTL2B (2)
- NAA80 (2)
- TRMT11 (2)
- TYRP1 (2)
- ADH6 (1)
- HGD (1)
- HPD (1)
- LCLAT1 (1)
- METTL6 (1)
- NAA10 (1)