Germany
Japan
United Kingdom
China
CRIP2 (Myc-DDK-tagged)-Human cysteine-rich protein 2 (CRIP2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
B Cell Lineage
View as table Download
Crip2 (Myc-DDK-tagged) - Mouse cysteine rich protein 2 (Crip2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, CRIP2 (Myc-DDK tagged) - Human cysteine-rich protein 2 (CRIP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF particles, CRIP2 (mGFP-tagged) - Human cysteine-rich protein 2 (CRIP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
CRIP2 (GFP-tagged) - Human cysteine-rich protein 2 (CRIP2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN405938 is the updated version of KN205938.
Crip2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503827 is the updated version of KN303827.
Crip2 (GFP-tagged) - Mouse cysteine rich protein 2 (Crip2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cysteine-rich protein 2 (CRIP2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRIP2 (Myc-DDK tagged) - Human cysteine-rich protein 2 (CRIP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF clone of Human cysteine-rich protein 2 (CRIP2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, CRIP2 (mGFP-tagged) - Human cysteine-rich protein 2 (CRIP2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
CRIP2 (Myc-DDK tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 (Myc-DDK tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 (GFP-tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CRIP2 (GFP-tagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Crip2 (Myc-DDK-tagged ORF) - Rat cysteine-rich protein 2 (Crip2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Crip2 (Myc-DDK-tagged ORF) - Rat cysteine-rich protein 2 (Crip2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Crip2 (Myc-DDK-tagged ORF) - Rat cysteine-rich protein 2 (Crip2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Lenti ORF clone of Crip2 (mGFP-tagged ORF) - Rat cysteine-rich protein 2 (Crip2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Crip2 (GFP-tagged ORF) - Rat cysteine-rich protein 2 (Crip2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Buy this product and get 50% off on the Lenti RapidTiter kit. Use Code: Rapid50
Crip2 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Crip2 (untagged) - Mouse cysteine rich protein 2 (Crip2), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cysteine-rich protein 2 (CRIP2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-CRIP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the middle region of human CRIP2. Synthetic peptide located within the following region: TLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP |
Transient overexpression lysate of cysteine-rich protein 2 (CRIP2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
CRIP2 (untagged)-Human cysteine-rich protein 2 (CRIP2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CRIP2 (untagged)-Human cysteine-rich protein 2 (CRIP2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CRIP2 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 178-208 amino acids from the C-terminal region of human CRIP2 |
qSTAR qPCR primer pairs against Homo sapiens gene CRIP2
Rabbit Polyclonal Anti-CRIP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRIP2 Antibody: synthetic peptide directed towards the N terminal of human CRIP2. Synthetic peptide located within the following region: EKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCP |
CRIP2 CRISPRa kit - CRISPR gene activation of human cysteine rich protein 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Crip2 CRISPRa kit - CRISPR gene activation of mouse cysteine rich protein 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene CRIP2
| Application | Plasmid of exact quantity for transcript copy number calculation |
CRIP2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
qPCR primer pairs and template standards against Mus musculus gene Crip2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Crip2
CRIP2 MS Standard C13 and N15-labeled recombinant protein (NP_001303)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Crip2 (untagged ORF) - Rat cysteine-rich protein 2 (Crip2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of cysteine-rich protein 2 (CRIP2) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
CRIP2 (untagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
CRIP2 (untagged) - Homo sapiens cysteine-rich protein 2 (CRIP2), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
CRIP2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Crip2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Crip2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
CRIP2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-208 of human CRIP2 (NP_001303.1). |
| Modifications | Unmodified |
CRIP2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
CRIP2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Crip2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Crip2 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Active filters
Target Symbol
- CRIP2