Germany
Japan
United Kingdom
China
USD 428.00
In Stock
Research Areas
View as table Download
Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188 |
| Modifications | Phospho-specific |
Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-CEBPE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEBPE. |
Rabbit polyclonal Estrogen Receptor-a (Ser102) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of serine 102 (L-N-SP-V-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-TCF4/12 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TCF4/12. |
Anti-TCF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 210 amino acids of human transcription factor 4 |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Tyr537) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Tyrosine 537 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser104) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 104 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser106) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 106 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser118) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 118 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- beta (Ser105) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- beta around the phosphorylation site of Serine 105 |
Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser118) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human and Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 118 (Q-L-SP-P-F). |
| Modifications | Phospho-specific |
Rabbit polyclonal C/EBP-beta (Ab-235/188) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human C/EBP-β around the phosphorylation site of threonine 235 (P-G-T-P-S). |
Rabbit polyclonal LEF1 Antibody (N-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1. |
Rabbit Polyclonal C/EBP-beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human C/EBP-beta |
Rabbit Polyclonal Anti-NFATC3 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC3 antibody: synthetic peptide directed towards the N terminal of human NFATC3. Synthetic peptide located within the following region: AVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSDDQGSLSPARETSI |
Rabbit anti Estrogen Receptor alpha (ER-alpha) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human estrogen receptor protein. This sequence is identical to human, Gorilla, Bovine, etc. |
Goat Polyclonal Antibody against LEF1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QHEQRKEQEPKRPH, from the internal region of the protein sequence according to NP_057353.1. |
Rabbit polyclonal anti-CEBPB antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CEBPB. |
Rabbit Polyclonal Anti-Rora Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rora antibody is synthetic peptide directed towards the middle region of Mouse Rora. Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK |
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) RORA mouse monoclonal antibody, clone OTI2E8 (formerly 2E8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RORA mouse monoclonal antibody, clone OTI2C4 (formerly 2C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RORA mouse monoclonal antibody,clone OTI5A6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
USD 465.00
In Stock
Anti-CEBPD Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta |
Anti-CEBPD Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 210-225 amino acids of Human CCAAT/enhancer-binding protein delta |
Rabbit Polyclonal Anti-ESR2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ESR2 |
Rabbit Polyclonal Anti-CEBPB Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CEBPB |
Active filters
Filter by
Target Symbol
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Acute myeloid leukemia (9)
- Pathways in cancer (9)
- Wnt signaling pathway (9)
- Adherens junction (8)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (8)
- Basal cell carcinoma (8)
- Colorectal cancer (8)
- Endometrial cancer (8)
- Melanogenesis (8)
- Prostate cancer (8)
- Thyroid cancer (8)
- Adipocytokine signaling pathway (4)
- Antigen processing and presentation (4)
- MAPK signaling pathway (4)
- Natural killer cell mediated cytotoxicity (4)
- T cell receptor signaling pathway (4)
- Allograft rejection (3)
- Alzheimer's disease (3)
- Amyotrophic lateral sclerosis (ALS) (3)
- Apoptosis (3)
- Asthma (3)
- Cytokine-cytokine receptor interaction (3)
- Dilated cardiomyopathy (3)
- Fc epsilon RI signaling pathway (3)
- Graft-versus-host disease (3)
- Hematopoietic cell lineage (3)
- Hypertrophic cardiomyopathy (HCM) (3)
- NOD-like receptor signaling pathway (3)
- RIG-I-like receptor signaling pathway (3)
- Systemic lupus erythematosus (3)
- TGF-beta signaling pathway (3)
- Toll-like receptor signaling pathway (3)
- Type I diabetes mellitus (3)
- Type II diabetes mellitus (3)
- Axon guidance (1)
- B cell receptor signaling pathway (1)
- Chemokine signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Pancreatic cancer (1)
- VEGF signaling pathway (1)