Research Areas

View as table Download

SRC (Myc-DDK-tagged)-Human v-src sarcoma (Schmidt-Ruppin A-2) viral oncogene homolog (avian) (SRC), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

USD 98.00

USD 390.00

In Stock

CDC42 (Myc-DDK-tagged)-Human cell division cycle 42 (GTP binding protein, 25kDa) (CDC42), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PRKCZ (Myc-DDK-tagged)-Human protein kinase C, zeta (PRKCZ), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, E (HLA-E)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, A (HLA-A)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, C (HLA-C)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, G (HLA-G)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, B (HLA-B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

HLA (GFP-tagged) - Human major histocompatibility complex, class I, G (HLA-G)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, A (HLA-A)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (untagged)-Human major histocompatibility complex, class I, G (HLA-G)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, E (HLA-E)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (Myc-DDK-tagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, B (HLA-B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, C (HLA-C)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Homo sapiens major histocompatibility complex, class I, A (HLA-A), transcript variant 2 (A*01:01:01:01 allele)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (Myc-DDK tagged) - Homo sapiens major histocompatibility complex, class I, A (HLA-A), transcript variant 2 (A*01:01:01:01 allele)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit polyclonal HLA-G Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G.

HLA (Myc-DDK tagged) - Homo sapiens major histocompatibility complex, class I, C (HLA-C), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Human major histocompatibility complex, class I, F (HLA-F), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (GFP-tagged) - Homo sapiens major histocompatibility complex, class I, C (HLA-C), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

HLA (untagged)-Human major histocompatibility complex, class I, E (HLA-E)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

HLA (untagged)-Human major histocompatibility complex, class I, C (HLA-C)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

HLA (untagged)-Human major histocompatibility complex, class I, A (HLA-A)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

HLA (untagged)-Human major histocompatibility complex, class I, E (HLA-E)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, clone B-F2, Azide Free

Applications FC, FN, IHC
Reactivities Human

c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE

Applications FC
Reactivities Human
Conjugation PE

HLA (untagged)-Human major histocompatibility complex, class I, B (HLA-B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

c Kit (KIT) mouse monoclonal antibody, clone B-K15, Azide Free

Applications FC, FN
Reactivities Human

HLAG (HLA-G) mouse monoclonal antibody, clone G233, Aff - Purified

Applications ELISA, FC, IP
Reactivities Human

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide surrounding amino acids 901-950 Glu930 of Human c-Kit.

Rabbit polyclonal HLA-B Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B.

Rabbit Polyclonal KIT (Tyr703) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human KIT around the phosphorylation site of Tyrosine 703
Modifications Phospho-specific

Rabbit Polyclonal Phospho-c-Kit (Tyr721) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human c-Kit around the phosphorylation site of Tyrosine 721.
Modifications Phospho-specific

Rabbit Polyclonal KIT Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human KIT.

Rabbit polyclonal Anti-HLA-F Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT

IL2 Receptor alpha (IL2RA) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

c Kit (KIT) rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

HLA (untagged)-Human major histocompatibility complex, class I, A (cDNA clone MGC:17191 IMAGE:4157200), complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

HLA (untagged)-Human major histocompatibility complex, class I, F (HLA-F), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

HLAG (HLA-G) mouse monoclonal antibody, clone MEM-G/1, Biotin

Applications IHC, WB
Reactivities Human
Conjugation Biotin