Products

View as table Download

Rabbit Polyclonal PPARGC1A Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A.

Rabbit Polyclonal Anti-SREBF2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SREBF2 antibody was raised against a 15 amino acid peptide near the center of human SREBF2.

Rabbit Polyclonal Anti-MALT1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MALT1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human MALT1.

Rabbit Polyclonal Anti-EIF4E2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4E2 antibody: synthetic peptide directed towards the N terminal of human EIF4E2. Synthetic peptide located within the following region: KDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQY

IKBKB Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human IKBKB

Rabbit Polyclonal ELK1 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

p38 (CRK) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat

FOXO1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen 15 amino acid peptide near the amino terminus of human FOXO1

Rabbit Polyclonal Antibody against EIF4E2 (N-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EIF4E2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 12-41 amino acids from the N-terminal region of human EIF4E2.

Rabbit polyclonal Elk-1(Ab-383) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human Elk-1 around the phosphorylation site of Serine 383.

FOXO1 / FKHR Mouse Monoclonal (aa242-655) (7h3) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Anti-CBL (phospho-Tyr700) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 770 (T-E-Y(p)-M-T) derived from Human c-Cbl.
Modifications Phospho-specific

Rabbit polyclonal FKHR (Phospho-Ser256) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human FKHR around the phosphorylation site of serine 256 (A-A-SP-M-D).
Modifications Phospho-specific

Mouse Monoclonal IKK beta Antibody (10AG2)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

FOXO1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

FOXO1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

FOXO1 pSer256 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

FOXO1 pSer319 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse

Rabbit polyclonal antibody to IKK beta (inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 493 and 739 of IKK beta (Uniprot ID#O14920)

Anti-FOXO1 (Phospho-Ser319) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 319 (T-S-S(p)-N-A) derived from Human FKHR/FOXO1A.
Modifications Phospho-specific

Anti-ELK1 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.387~391 (P-R-S-P-A) derived from Human Elk1.

Rabbit polyclonal FOXO1/3/4-pan (Ab-24/32) antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human FOXO1/3/4-pan.

FOXO1 pSer256 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

FOXO1 pSer319 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

p38 (CRK) (CRK-II, pTry221) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

FOXO1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

FOXO1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit anti-FKHR (Phospho-Ser256) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanFKHR around the phosphorylation site of serine 256 (A-A-SP-M-D).
Modifications Phospho-specific

Rabbit anti-FKHR (Phospho-Ser319) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanFKHR around the phosphorylation site of serine 319 (T-S-SP-N-A).
Modifications Phospho-specific

Rabbit polyclonal anti-IKK beta antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IKKb peptide corresponding to the highly conserved C-terminus region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Anti-ELK1 (Phospho-Ser389) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 389 (P-R-S(p)-P-A) derived from Human Elk-1.
Modifications Phospho-specific

Rabbit Polyclonal Anti-SREBF1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SREBF1 antibody: synthetic peptide directed towards the middle region of human SREBF1. Synthetic peptide located within the following region: DAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR

CBL rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T)

CBL rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human
Immunogen Synthesized non-phosphopeptide derived from human c-Cbl around the phosphorylation site of tyrosine 700 (T-E-YP-M-T)

p38 (CRK) (CRK-II) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 200-250 of Human Crk2.

Rabbit anti-ELK1 (Phospho-Thr417) polyclonal antibody (Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanElk-1 around the phosphorylation site of threonine 417 (L-S-TP-P-V).
Modifications Phospho-specific

Carrier-free (BSA/glycerol-free) PRKAR1A mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI1C1 (formerly 1C1)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) EIF4E2 mouse monoclonal antibody, clone OTI4E7 (formerly 4E7)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CRK Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CRK

Rabbit Polyclonal Anti-IKBKB Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IKBKB

Anti-PRKAR1A (PKA regulatory subunit I alpha) mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PRKAR1A mouse monoclonal antibody, clone 6C7, Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

PRKAR1A mouse monoclonal antibody, clone 6C7, HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-PRKAR1A (PKA regulatory subunit I alpha) mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

EIF4E2 mouse monoclonal antibody, clone OTI1F11 (formerly 1F11), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Biotin