Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified
| Applications | FC, IHC |
| Reactivities | Human |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit Polyclonal Anti-ARC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARC |
TA349251 is a possible alternative to TA349500.
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit anti-ITGB2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ITGB2 |
Rabbit Polyclonal Anti-NFATC2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFATC2 antibody: synthetic peptide directed towards the C terminal of human NFATC2. Synthetic peptide located within the following region: PTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal antibody to KLRC1 (killer cell lectin-like receptor subfamily C, member 1)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of KLRC1 (Uniprot ID#P26715) |
Rabbit anti-ITGAL Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human ITGAL |
Rabbit anti-IFNGR1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNGR1 |
Active filters
Applications
- IHC
Pathways
- Natural killer cell mediated cytotoxicity
Filter by
Category
Target Symbol
- MAP2K1 (183)
- PIK3CG (54)
- PIK3R5 (37)
- BID (36)
- BRAF (30)
- MAPK1 (29)
- PIK3CD (28)
- HRAS (27)
- CSF2 (24)
- PIK3CA (23)
- CASP3 (22)
- TNFRSF10B (22)
- PAK1 (20)
- MAP2K2 (19)
- TNF (19)
- CHP1 (17)
- SHC1 (16)
- GZMB (15)
- PRF1 (12)
- ARAF (11)
- RAF1 (11)
- PPP3CA (10)
- PIK3R1 (9)
- PRKCA (9)
- ZAP70 (9)
- MAPK3 (8)
- NRAS (8)
- ICAM1 (7)
- FASLG (6)
- GRB2 (6)
- NCR2 (6)
- PTPN11 (6)
- SYK (6)
- IFNGR2 (5)
- NFATC4 (5)
- PTK2B (5)
- PTPN6 (5)
- CD247 (4)
- FCGR3A (4)
- FYN (4)
- IFNB1 (4)
- IFNG (4)
- ITGB2 (4)
- NFATC1 (4)
- CD48 (3)
- FAS (3)
- ITGAL (3)
- PLCG1 (3)
- TNFSF10 (3)
- TYROBP (3)
- HLA-G (2)
- IFNA2 (2)
- IFNAR1 (2)
- IFNGR1 (2)
- KIR2DL3 (2)
- KLRC1 (2)
- LCK (2)
- LCP2 (2)
- NFATC2 (2)
- NFATC3 (2)
- PIK3R3 (2)
- PPP3CC (2)
- PRKCB (2)
- RAC1 (2)
- TNFRSF10C (2)
- VAV2 (2)
- CD244 (1)
- HLA-A (1)
- HLA-B (1)
- ICAM2 (1)
- IFNA16 (1)
- IFNA8 (1)
- IFNAR2 (1)
- KIR2DL4 (1)
- KIR3DL1 (1)
- KLRC2 (1)
- KLRK1 (1)
- NCR1 (1)
- NCR3 (1)
- NFAT5 (1)
- PIK3CB (1)
- PIK3R2 (1)
- PLCG2 (1)
- PPP3CB (1)
- PPP3R2 (1)
- PRKCG (1)
- RAC2 (1)
- RAET1E (1)
- SH2D1B (1)
- SH3BP2 (1)
- SHC3 (1)
- TNFRSF10D (1)
- ULBP1 (1)
- VAV1 (1)
- VAV3 (1)