Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Anti-PNPLA3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS |
USD 379.00
In Stock
USD 379.00
In Stock
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG |
Rabbit Polyclonal Anti-FAH Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT |
Rabbit Polyclonal Anti-GOT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV |
Rabbit Polyclonal Anti-DDC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV |
USD 450.00
2 Weeks
Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)
| Applications | IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709) |
Rabbit polyclonal Tyrosine Hydroxylase (Ab-19) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q). |
Rabbit polyclonal Tyrosine Hydroxylase (Ser19)(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q). |
| Modifications | Phospho-specific |
Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat |
| Conjugation | Unconjugated |
| Immunogen | Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%). |
Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%). |
Anti-COMT Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%). |
Rabbit polyclonal ADH1B Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit polyclonal ADH7 Antibody (C-Term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-346 amino acids from the C-terminal region of human ADH7. |
Rabbit Polyclonal Anti-TYRP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
TRP2 (DCT) (N-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 62-89 amino acids from the N-terminal region of human DCT. |
Tyrosine Hydroxylase (TH) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Two antipeptide antibodies were generated in Chickens against sequences shared between the Mouse (P24529) and Human (P07101) gene products. Production: After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 0.2 mg/ml. Finally, equal volumes of both of these affinity purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
Goat Anti-AOC3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DEDPSFYSADSIY, from the internal region (near the C Terminus) of the protein sequence according to NP_003725.1. |
Rabbit polyclonal ADH4 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ADH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-348 amino acids from the C-terminal region of human ADH4. |
Rabbit polyclonal AOC3 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3. |
Goat Polyclonal Antibody against thyroid peroxidase
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Active filters
Applications
- IHC
Pathways
- Tyrosine metabolism
Filter by
Category
Target Symbol
- PNMT (30)
- ADH1B (29)
- TH (25)
- ALDH1A3 (20)
- ADH5 (16)
- LCMT1 (16)
- ALDH3A1 (15)
- ADH7 (11)
- MAOA (11)
- TYR (11)
- COMT (7)
- ADH4 (5)
- DCT (4)
- FAH (4)
- GOT1 (4)
- PNPLA3 (4)
- ALDH3B1 (3)
- AOX1 (3)
- DBH (3)
- MAOB (3)
- ADH1A (2)
- AOC3 (2)
- DDC (2)
- GOT2 (2)
- TAT (2)
- TPO (2)
- ADH6 (1)
- ALDH3B2 (1)
- BUD23 (1)
- HEMK1 (1)
- LCMT2 (1)
- MIF (1)
- TYRP1 (1)