Rabbit Polyclonal Anti-LSM6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM6 antibody: synthetic peptide directed towards the middle region of human LSM6. Synthetic peptide located within the following region: YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRR |
Rabbit Polyclonal Anti-EXOSC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC2 antibody: synthetic peptide directed towards the middle region of human EXOSC2. Synthetic peptide located within the following region: AEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCG |
Rabbit Polyclonal Anti-LSM1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM1 antibody: synthetic peptide directed towards the middle region of human LSM1. Synthetic peptide located within the following region: SDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDE |
Rabbit Polyclonal Anti-DIS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DIS3 antibody is: synthetic peptide directed towards the N-terminal region of Human DIS3. Synthetic peptide located within the following region: QTVLQEVRNRSAPVYKRIRDVTNNQEKHFYTFTNEHHRETYVEQEQGENA |
Rabbit Polyclonal Anti-DIS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DIS3 antibody: synthetic peptide directed towards the N terminal of human DIS3. Synthetic peptide located within the following region: DIVAVELLPKSQWVAPSSVVLHDEGQNEEDVEKEEETERMLKTAVSEKML |
Rabbit Polyclonal Anti-CNOT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNOT6 antibody: synthetic peptide directed towards the N terminal of human CNOT6. Synthetic peptide located within the following region: EISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDIAKLHNLVYLDLSSN |
Rabbit Polyclonal Anti-EXOSC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EXOSC3 antibody is: synthetic peptide directed towards the C-terminal region of Human EXOSC3. Synthetic peptide located within the following region: RNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFK |
Rabbit Polyclonal Anti-LSM8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LSM8 antibody: synthetic peptide directed towards the N terminal of human LSM8. Synthetic peptide located within the following region: MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQ |
Rabbit Polyclonal Anti-PAPOLB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPOLB antibody: synthetic peptide directed towards the N terminal of human PAPOLB. Synthetic peptide located within the following region: TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESK |
Rabbit Polyclonal Anti-PAPOLB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPOLB antibody: synthetic peptide directed towards the middle region of human PAPOLB. Synthetic peptide located within the following region: MEEFRTMWVIGLGLKKPDNSEILSIDLTYDIQSFTDTVYRQAVNSKMFEM |
Rabbit Polyclonal Anti-PAPOLG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAPOLG antibody: synthetic peptide directed towards the middle region of human PAPOLG. Synthetic peptide located within the following region: SVDAIGGESMPIPTIDTSRKKRLPSKELPDSSSPVPANNIRVIKNSIRLT |
Rabbit Polyclonal Anti-EXOSC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC6 antibody: synthetic peptide directed towards the N terminal of human EXOSC6. Synthetic peptide located within the following region: LYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSG |
Rabbit Polyclonal Anti-DCP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the middle region of human DCP2. Synthetic peptide located within the following region: KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP |
Rabbit Polyclonal Anti-DCP2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the C terminal of human DCP2. Synthetic peptide located within the following region: VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK |
Rabbit Polyclonal Anti-DCP1A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP1A antibody: synthetic peptide directed towards the N terminal of human DCP1A. Synthetic peptide located within the following region: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDI |
Rabbit Polyclonal Anti-EXOSC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: VIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQAISSRL |
Rabbit Polyclonal Anti-GRP75 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRP75 Antibody: A synthesized peptide derived from human GRP75 |
Rabbit Polyclonal Anti-HSP60 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSP60 Antibody: A synthesized peptide derived from human HSP60 |
Rabbit Polyclonal Anti-NSE Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NSE Antibody: A synthesized peptide derived from human NSE |
Rabbit Polyclonal Anti-XRN2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XRN2 Antibody: A synthesized peptide derived from human XRN2 |
Rabbit Polyclonal Anti-DCP1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCP1A Antibody: A synthesized peptide derived from human DCP1A |
Rabbit Polyclonal Anti-b-Enolase(ENO-3) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-b-Enolase(ENO-3) Antibody: Peptide sequence around aa.49~53(L-R-D-G-D) derived from Human b-Enolase(ENO-3). |
Rabbit Polyclonal Anti-GRP75 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRP75 Antibody: A synthesized peptide derived from human GRP75 |
NSE (ENO2) mouse monoclonal antibody, clone NSE-P2, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
Hsp60 (HSPD1) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide mapping at the middle region of human HSP60 |
NSE (ENO2) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Chickens were immunized with two synthetic peptide KLH conjugates corresponding to different regions of the NSE-2 gene product, but are shared between the Human (NP_001966, NCBI) and Rat (AAA41119) sequences. Production: After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 0.2 mg/ml. Finally, equal volumes of each of these affinity-purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
Rabbit polyclonal CNOT2 (Ab-101) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CNOT2 around the phosphorylation site of serine 101 (S-L-SP-Q-G). |
Rabbit polyclonal anti-CNOT7 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CNOT7. |
USD 450.00
5 Days
Mouse monoclonal ENO1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal HSPD1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 396-423 amino acids from the C-terminal region of human HSPD1. |
Rabbit polyclonal DCP1A antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DCP1A. |
Mouse monoclonal Grp75 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat. Other species not tested yet |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the C terminal of human ENO1. Synthetic peptide located within the following region: VVGLCTGQIKTGAPCRSERLAKYNQLLRIEEELGSKAKFAGRNFRNPLAK |
Rabbit Polyclonal Anti-ENO1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ENO1 Antibody: synthetic peptide directed towards the middle region of human ENO1. Synthetic peptide located within the following region: VAASEFFRSGKYDLDFKSPDDPSRYISPDQLADLYKSFIKDYPVVSIEDP |
Rabbit Polyclonal HSP60 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Hamster, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human Hsp60 protein (within residues 70-150). [Swiss-Prot P10809] |
Mouse Monoclonal Hsp60 Antibody
| Applications | IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NSE (ENO2) mouse monoclonal antibody, clone 145, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NSE (ENO2) mouse monoclonal antibody, clone 1G6, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NSE (ENO2) mouse monoclonal antibody, clone AT17D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Germany
Japan
United Kingdom
China
