Germany
Japan
United Kingdom
China
USD 405.00
2 Weeks
beta Actin (ACTB) (Loading Control) mouse monoclonal antibody, clone G043, Aff - Purified
| Applications | IF, WB |
| Reactivities | All Species |
Products
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-YBX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSDA antibody: synthetic peptide directed towards the N terminal of human CSDA. Synthetic peptide located within the following region: AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN |
Rabbit Polyclonal Anti-CLDN18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the middle region of human CLDN18. Synthetic peptide located within the following region: LVTNFWMSTANMYTGMGGMVQTVQTRYTFGAALFVGWVAGGLTLIGGVMM |
Rabbit Polyclonal Anti-CLDN18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18. Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the C terminal of human ACTN4. Synthetic peptide located within the following region: DVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETTDTDTADQVI |
USD 465.00
2 Weeks
SRC (N-term) (incl. pos. control) mouse monoclonal antibody, clone 11F1, Purified
| Applications | ELISA, WB |
| Reactivities | Canine, Human, Mouse, Rat |
USD 480.00
2 Weeks
Cingulin (CGN) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rabbit, Xenopus |
| Immunogen | Full length GST-fusion protein of Human Cingulin |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal CLDN1 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | CLDN1 antibody was raised against a 20 amino acid synthetic peptide near the carboxy terminus of human CLDN1. The immunogen is located within the last 50 amino acids of CLDN1. |
Rabbit polyclonal CDK4 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Rabbit polyclonal NRAS Antibody (N-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NRAS antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-101 amino acids from the N-terminal region of human NRAS. |
Rabbit anti-CDC42 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDC42 |
CLDN3 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human CLDN3 |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit anti-CTNNA1 Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CTNNA1 |
Rabbit Polyclonal Anti-CLDN23 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN23 antibody: synthetic peptide directed towards the C terminal of human CLDN23. Synthetic peptide located within the following region: IKYYSDGQHRPPPAQHRKPKPKPKVGFPMPRPRPKAYTNSVDVLDGEGWE |
Rabbit Polyclonal Anti-PPP2R2C Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ppp2r2c antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNAPHSQGEYDVY |
Rabbit Polyclonal Anti-Phospho-HS1(Tyr378) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-HS1(Tyr378) Antibody: A synthesized peptide derived from human HS1 around the phosphorylation site of Tyrosine 378 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ACTB |
USD 230.00
2 Weeks
USD 405.00
2 Weeks
smooth muscle Myosin heavy chain 11 (MYH11) (smooth) mouse monoclonal antibody, clone MS-13, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Rat |
AKT1 (C-term) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
Rabbit Polyclonal antibody to alpha Actinin 4 (actinin, alpha 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 206 and 542 of alpha Actinin 4 (Uniprot ID#O43707) |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Anti-PRKCQ (Phospho-Ser676) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 676 (R-L-S(p)-F-A) derived from Human PKC?. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Akt (Thr308) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Akt around the phosphorylation site of Threonine 308 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Src (Tyr418) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 418 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Src (Tyr529) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Src around the phosphorylation site of Tyrosine 529 |
| Modifications | Phospho-specific |
AKT2 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT2 |
F11R Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human F11R |
Active filters
Category
-
- Antibodies
-
Pathways
- Tight junction
Filter by
Target Symbol
- CTNNB1 (162)
- AKT1 (127)
- PRKCE (64)
- KRAS (58)
- HRAS (47)
- AKT2 (44)
- ACTB (38)
- SHC1 (32)
- SRC (30)
- PRKCA (27)
- MYL7 (26)
- CLDN6 (25)
- PTEN (23)
- AKT3 (19)
- MPP5 (19)
- PPP2R1B (19)
- PRKCD (19)
- CLDN3 (17)
- NRAS (17)
- CTTN (16)
- ACTN1 (15)
- F11R (15)
- CLDN5 (13)
- CLDN7 (13)
- VAPA (13)
- EXOC4 (12)
- PRKCB (12)
- CLDN1 (11)
- CTNNA1 (11)
- PRKCQ (11)
- CSNK2A1 (10)
- GNAI1 (10)
- SPTAN1 (10)
- CDK4 (9)
- MYL9 (9)
- PPP2CA (9)
- RHOA (9)
- ACTN2 (8)
- CLDN11 (8)
- CLDN4 (8)
- HCLS1 (8)
- PPP2R1A (8)
- PRKCZ (8)
- RRAS (8)
- ACTG1 (7)
- MYH1 (7)
- MYH11 (7)
- TJP1 (7)
- ACTN3 (6)
- ACTN4 (6)
- CLDN10 (6)
- CLDN2 (6)
- MYH9 (6)
- MYL2 (6)
- PARD6A (6)
- PPP2R2B (6)
- PRKCG (6)
- CDC42 (5)
- CLDN18 (5)
- CLDN8 (5)
- EPB41 (5)
- MRAS (5)
- CLDN14 (4)
- CLDN19 (4)
- CSNK2B (4)
- EPB41L2 (4)
- GNAI2 (4)
- JAM2 (4)
- MAGI2 (4)
- PARD3 (4)
- RRAS2 (4)
- YBX3 (4)
- YES1 (4)
- AMOTL1 (3)
- CASK (3)
- CLDN15 (3)
- CLDN16 (3)
- CLDN23 (3)
- CSNK2A2 (3)
- GNAI3 (3)
- MYH7 (3)
- PPP2R2A (3)
- PRKCH (3)
- TJAP1 (3)
- TJP2 (3)
- EPB41L3 (2)
- JAM3 (2)
- LLGL1 (2)
- MAGI3 (2)
- MAP3K20 (2)
- MLLT4 (2)
- MYL12B (2)
- PPP2CB (2)
- PPP2R2D (2)
- SYMPK (2)
- AFDN (1)
- CGN (1)
- CLDN17 (1)
- CLDN22 (1)
- CLDN9 (1)
Reactivities
- Human (1129)
- Mouse (975)
- Rat (917)
- Monkey (183)
- Dog (178)
- Chicken (19)
- Bovine (16)
- Pig (15)
- Rabbit (13)
- Cow (10)
- Xenopus (8)
- Rhesus Monkey (6)
- Zebrafish (5)
- Canine (4)
- Drosophila (4)
- Hamster (4)
- X. tropicalis (3)
- Chimpanzee (2)
- Guinea Pig (2)
- Porcine (2)
- Primate (2)
- Sheep (2)
- All Species (1)
- Avian (1)
- Broad (1)
- Canis (1)
- Fish (1)
- Frog (1)
- Goat (1)