Products

Download

Rabbit Polyclonal UNG1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UNG1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human UNG1.

Rabbit Polyclonal UNG1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen UNG1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human UNG1.

Rabbit polyclonal anti-IKK-gamma antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IKK-?.

Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P).
Modifications Phospho-specific

Rabbit polyclonal anti-CD79A antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CD79A.

Rabbit polyclonal anti-UNG antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human UNG.

Rabbit polyclonal BTK (Tyr223) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 223 (A-L-YP-D-Y).
Modifications Phospho-specific

Rabbit polyclonal anti-AIRE antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AIRE.

Rabbit polyclonal AIRE (Ser156) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AIRE around the phosphorylation site of serine 156 (P-G-SP-Q-L).
Modifications Phospho-specific

Rabbit polyclonal anti-CIITA antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CIITA.

Goat polyclonal anti-Artemis antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 482-495 of Human ARTEMIS (DCLRE1C DNA cross-link repair 1C).

Rabbit Polyclonal CIITA Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CIITA antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CIITA.

Mouse Anti-Human CD45RA Purified (100 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal ZAP70 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ZAP70 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-304 amino acids from the Central region of human ZAP70.

Rabbit polyclonal LCK Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 480-509 amino acids from the C-terminal region of human LCK.

Rabbit Polyclonal BLNK Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BLNK

Rabbit Polyclonal BLNK (Tyr96) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human BLNK around the phosphorylation site of Tyrosine 96
Modifications Phospho-specific

Rabbit Polyclonal IKK-gamma Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-gamma

Rabbit Polyclonal IKK-? Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-?

Rabbit Polyclonal IKK- gamma (Ser31) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK- gamma around the phosphorylation site of Serine 31
Modifications Phospho-specific

Rabbit Polyclonal IKK-? (Ser85) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human IKK-? around the phosphorylation site of Serine 85
Modifications Phospho-specific

Rabbit Polyclonal Lck Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Lck

Rabbit Polyclonal Lck Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Lck

Rabbit Polyclonal Lck (Tyr393) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Lck around the phosphorylation site of Tyrosine 393
Modifications Phospho-specific

Rabbit Polyclonal CD45 (Ser1007) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD45 around the phosphorylation site of Serine 1007
Modifications Phospho-specific

Rabbit polyclonal CD19 (Ab-531) antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human CD19 around the phosphorylation site of tyrosine 531 (D-S-YP-E-N).

Rabbit Polyclonal ZAP-70 Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human ZAP-70

Rabbit Polyclonal Anti-TAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Rabbit Polyclonal TACI/TNFRSF13B/CVID Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This rabbit polyclonal antibody was developed against a synthetic peptide corresponding to amino acids 116-132 of human TACI. Human and mouse TACI amino acid sequences are 65% conserved in the immunogen.

Mouse Monoclonal BTK Antibody (7F12H4)

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
TA336560 is a replacement of AM06170SU-N.

Rabbit Polyclonal RFX-AP Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFX-AP antibody: RFXAP (Regulatory factor X-associated protein), using the recombinant protein.

Rabbit Polyclonal CD4 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N Terminus Region

CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7

Applications FC, IHC
Reactivities Human
Conjugation APC-Cy7

CD8A mouse monoclonal antibody, clone RFT-8, Cy5

Applications FC, IHC
Reactivities Human
Conjugation Cy5

CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin

Applications FC, IHC
Reactivities Human

CD8A mouse monoclonal antibody, clone RFT-8, Purified

Applications FC, IHC
Reactivities Human

CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5

Applications FC, IHC
Reactivities Human
Conjugation PE-Cy5.5

CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7

Applications FC, IHC
Reactivities Human
Conjugation PE-Cy7

CD3E mouse monoclonal antibody, clone JXT3, Aff - Purified

Applications ELISA, IF
Reactivities Human
Conjugation Unconjugated

CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified

Applications IHC, IP
Reactivities Human, Rat

CD4 mouse monoclonal antibody, clone CA-4, Purified

Applications IF, IHC
Reactivities Human

CD19 mouse monoclonal antibody, clone 4G7, Purified

Applications FC, IF
Reactivities Human

CD19 mouse monoclonal antibody, clone 4G7, PE

Applications FC
Reactivities Human
Conjugation PE

CD19 mouse monoclonal antibody, clone AE1, Aff - Purified

Applications FC, IHC
Reactivities Human

CD3E mouse monoclonal antibody, clone CRIS-7, Aff - Purified

Applications FC, IHC
Reactivities Human, Rhesus Monkey

CD3E mouse monoclonal antibody, clone B-B11, PE

Applications FC
Reactivities Human
Conjugation PE

CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Azide Free

Applications FC, IHC
Reactivities Human

CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Purified

Applications FC, IHC
Reactivities Human

CD8A mouse monoclonal antibody, clone B-Z31, Azide Free

Applications FC, IHC
Reactivities Human