Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human UNG1. |
Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human UNG1. |
Rabbit Polyclonal UNG1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | UNG1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human UNG1. |
Rabbit polyclonal anti-IKK-gamma antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IKK-?. |
Rabbit polyclonal IKK-gamma (Ser376) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-? around the phosphorylation site of serine 376 (Y-L-SP-S-P). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CD79A antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CD79A. |
Rabbit polyclonal anti-UNG antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human UNG. |
Rabbit polyclonal BTK (Tyr223) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human BTK around the phosphorylation site of tyrosine 223 (A-L-YP-D-Y). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-AIRE antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AIRE. |
Rabbit polyclonal AIRE (Ser156) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AIRE around the phosphorylation site of serine 156 (P-G-SP-Q-L). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CIITA antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CIITA. |
Goat polyclonal anti-Artemis antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole goat serum produced by repeated immunizations with a synthetic peptide corresponding aa 482-495 of Human ARTEMIS (DCLRE1C DNA cross-link repair 1C). |
Rabbit Polyclonal CIITA Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CIITA antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human CIITA. |
Mouse Anti-Human CD45RA Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal ZAP70 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ZAP70 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 276-304 amino acids from the Central region of human ZAP70. |
Rabbit polyclonal LCK Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 480-509 amino acids from the C-terminal region of human LCK. |
Rabbit Polyclonal BLNK Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BLNK |
Rabbit Polyclonal BLNK (Tyr96) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human BLNK around the phosphorylation site of Tyrosine 96 |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK-gamma Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-gamma |
Rabbit Polyclonal IKK-? Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-? |
Rabbit Polyclonal IKK- gamma (Ser31) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- gamma around the phosphorylation site of Serine 31 |
Modifications | Phospho-specific |
Rabbit Polyclonal IKK-? (Ser85) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-? around the phosphorylation site of Serine 85 |
Modifications | Phospho-specific |
Rabbit Polyclonal Lck Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lck |
Rabbit Polyclonal Lck Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lck |
Rabbit Polyclonal Lck (Tyr393) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Lck around the phosphorylation site of Tyrosine 393 |
Modifications | Phospho-specific |
Rabbit Polyclonal CD45 (Ser1007) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CD45 around the phosphorylation site of Serine 1007 |
Modifications | Phospho-specific |
Rabbit polyclonal CD19 (Ab-531) antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CD19 around the phosphorylation site of tyrosine 531 (D-S-YP-E-N). |
Rabbit Polyclonal ZAP-70 Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human ZAP-70 |
Rabbit Polyclonal Anti-TAP1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Rabbit Polyclonal TACI/TNFRSF13B/CVID Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This rabbit polyclonal antibody was developed against a synthetic peptide corresponding to amino acids 116-132 of human TACI. Human and mouse TACI amino acid sequences are 65% conserved in the immunogen. |
Mouse Monoclonal BTK Antibody (7F12H4)
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Rabbit Polyclonal RFX-AP Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RFX-AP antibody: RFXAP (Regulatory factor X-associated protein), using the recombinant protein. |
Rabbit Polyclonal CD4 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the N Terminus Region |
CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7
Applications | FC, IHC |
Reactivities | Human |
Conjugation | APC-Cy7 |
CD8A mouse monoclonal antibody, clone RFT-8, Cy5
Applications | FC, IHC |
Reactivities | Human |
Conjugation | Cy5 |
CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, Purified
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE-Cy5.5 |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE-Cy7 |
CD3E mouse monoclonal antibody, clone JXT3, Aff - Purified
Applications | ELISA, IF |
Reactivities | Human |
Conjugation | Unconjugated |
ZAP70 (full length) mouse monoclonal antibody, clone 11H40, Purified
Applications | IHC, WB |
Reactivities | Human, Rat |
CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified
Applications | IHC, IP |
Reactivities | Human, Rat |
CD4 mouse monoclonal antibody, clone CA-4, Purified
Applications | IF, IHC |
Reactivities | Human |
CD19 mouse monoclonal antibody, clone 4G7, Purified
Applications | FC, IF |
Reactivities | Human |
CD19 mouse monoclonal antibody, clone 4G7, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD19 mouse monoclonal antibody, clone AE1, Aff - Purified
Applications | FC, IHC |
Reactivities | Human |
CD3E mouse monoclonal antibody, clone CRIS-7, Aff - Purified
Applications | FC, IHC |
Reactivities | Human, Rhesus Monkey |
CD3E mouse monoclonal antibody, clone B-B11, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Azide Free
Applications | FC, IHC |
Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone B-C15, Purified
Applications | FC, IHC |
Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Azide Free
Applications | FC, IHC |
Reactivities | Human |