Products

View as table Download

PTCH1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1)

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.

Rabbit Polyclonal Anti-WNT9B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the C terminal of human WNT9B. Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Goat Polyclonal Anti-NPHS2 / SRN1 Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-NPHS2 / SRN1 Antibody: Peptide with sequence C-SPSKPVEPLNPKK, from the C Terminus of the protein sequence according to NP_055440.1.

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

Rabbit Polyclonal Wnt10a Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10a antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Wnt10a.

WNT3 (315-329) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Chicken, Equine, Human, Monkey, Mouse, Porcine, Rat, Xenopus, Zebrafish
Immunogen Synthetic peptide from an internal region of human WNT3

Smoothened (SMO) (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen SMO antibody was raised against synthetic peptide - KLH conjugated

BMP2 (+ BMP4) rabbit polyclonal antibody, Purified

Applications ELISA, IP, WB
Reactivities Human
Immunogen Highly purified Synthetic peptide C-terminal (20 amino acids) of Human BMP-2/4.

Goat Polyclonal Antibody against WNT4

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-SNWLYLAKLSSVGS, from the internal region of the protein sequence according to NP_110388.2.

Goat Polyclonal Antibody against SMO (Internal region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QSDDEPKRIKKS, from the internal region of the protein sequence according to NP_005622.1.

Rabbit polyclonal antibody to WNT10A (wingless-type MMTV integration site family, member 10A)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 47 and 271 of WNT10A (Uniprot ID#Q9GZT5)

Rabbit polyclonal anti-Wnt-6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 276 of mouse Wnt-6

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]

Rabbit Polyclonal Anti-WNT9B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the middle region of human WNT9B. Synthetic peptide located within the following region: CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA

Rabbit Polyclonal Anti-WNT16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN

Rabbit Polyclonal Anti-WNT16 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG

Rabbit Polyclonal Anti-WNT7B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

Rabbit Polyclonal Anti-Patched Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Patched Antibody: A synthesized peptide derived from human Patched

Sonic Hedgehog (SHH) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence near the N-terminal of human SHH

Rabbit polyclonal anti-WNT1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human WNT1.

Rabbit Polyclonal WNT4 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

PTCH1 (1431-1442) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bat, Canine, Equine, Human, Monkey
Immunogen Synthetic peptide from C-terminus of human PTCH1

WNT9A (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human WNT9A

Goat Polyclonal Antibody against WNT3

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence CGRGHNTRTEKRKEK, from the internal region of the protein sequence according to NP_110380.1.

Goat Polyclonal Antibody against PTCH

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-HPESRHHPPSNPRQQ, from the internal region of the protein sequence according to NP_000255.1.

Rabbit polyclonal anti-SMO antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SMO.

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Immunogen WNT7A antibody was raised against synthetic 10 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Chicken, Platypus, Xenopus (80%).

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).

Anti-WNT9A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A

Rabbit polyclonal WNT16 Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This WNT16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-265 amino acids from the C-terminal region of human WNT16.

Rabbit Polyclonal Anti-SHH Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SHH antibody: synthetic peptide directed towards the N terminal of human SHH. Synthetic peptide located within the following region: RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Rabbit Polyclonal Anti-PTCH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTCH1 antibody: synthetic peptide directed towards the C terminal of human PTCH1. Synthetic peptide located within the following region: TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM

Rabbit Polyclonal Anti-WNT16 Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen WNT16 antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT16. Percent identity with other species by BLAST analysis: Human, Mouse, Rat, Hamster (100%); Gorilla, Monkey, Marmoset (94%); Gibbon, Elephant, Panda, Dog, Horse, Turkey (88%); Bovine, Rabbit, Opossum, Platypus (81%).

Rabbit Polyclonal Anti-SMO Antibody (1st Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen SMO / Smoothened antibody was raised against synthetic 16 amino acid peptide from 1st extracellular domain of human SMO. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus (94%); Opossum (88%).

Smoothened (SMO) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from the human SMO protein

Smoothened (SMO) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from the human SMO protein

WNT1 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human WNT1

WNT4 (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human WNT4

WNT4 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the Center region of human WNT4

IHH (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 50-80aa) of human Indian hedgehog protein / IHH.

Smoothened (SMO) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 538-567 amino acids from the Central region of human SMO

WNT6 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 172-201 amino acids from the Central region of human WNT6

WNT9A (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 223-252 amino acids from the Central region of human WNT9A

Goat Anti-WNT15 / WNT9B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRGNKDLRARADA, from the internal region of the protein sequence according to NP_003387.1.

Rabbit Polyclonal Patched 1 Antibody

Applications WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 269-279 of the human and mouse PTCH protein.

Rabbit Polyclonal Patched 2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen residues 226-235 [GPFASLEGFR] of the human PTCH2 protein

WNT6 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit
Conjugation Unconjugated
Immunogen WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%).

WNT6 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Mouse, Rabbit, Rat
Immunogen WNT6 antibody was raised against synthetic 20 amino acid peptide from N-terminus of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit (100%); Marmoset, Bat, Opossum, Platypus (95%).