Germany
Japan
United Kingdom
China
RAD17 (GFP-tagged) - Human RAD17 homolog (S. pombe) (RAD17), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadRAD17 (GFP-tagged) - Human RAD17 homolog (S. pombe) (RAD17), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAD17 (GFP-tagged) - Human RAD17 homolog (S. pombe) (RAD17), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human RAD17 homolog (S. pombe) (RAD17), transcript variant 7, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human RAD17 homolog (S. pombe) (RAD17), transcript variant 8, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-RAD17 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RAD17 |
Rabbit Polyclonal Anti-RAD17 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD17 Antibody: A synthesized peptide derived from human RAD17 |
Lenti ORF clone of Human RAD17 homolog (S. pombe) (RAD17), transcript variant 8, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human RAD17 homolog (S. pombe) (RAD17), transcript variant 7, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RAD17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAD17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAD17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 8
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 6
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 7
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 8
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 7
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal anti-RAD17 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the C terminal of human RAD17. Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT |
Rabbit Polyclonal anti-RAD17 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD17 antibody: synthetic peptide directed towards the N terminal of human RAD17. Synthetic peptide located within the following region: MNQVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRF |
Rabbit Polyclonal Rad17 Antibody
| Applications | WB |
| Reactivities | Yeast |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to Schizosaccharomyces pombe RAD17. |
Rabbit Polyclonal Rad17 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to a N-terminal region of human RAD17. |
RAD17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAD17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAD17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAD17 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY408874 is the same product as LY430014.
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY408878 is the same product as LY430018.
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 6
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY408879 is the same product as LY430019.
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 8
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of RAD17 homolog (S. pombe) (RAD17), transcript variant 6
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RAD17 (GFP-tagged) - Human RAD17 homolog (S. pombe) (RAD17), transcript variant 9
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 3
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 5
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RAD17 (untagged)-Human RAD17 homolog (S. pombe) (RAD17), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
RAD17 (untagged) - Human RAD17 homolog (S. pombe) (RAD17), transcript variant 9
| Vector | pCMV6 series |
| Tag | Tag Free |
Rabbit Polyclonal Anti-RAD17 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RAD17 |
Transient overexpression of RAD17 (NM_002873) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAD17 (NM_133340) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAD17 (NM_133343) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RAD17 (NM_133344) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- RAD17
Families
- Druggable Genome