Products

Primary Antibodies (143)
View as table Download

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-DLD Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human DLD

Rabbit Polyclonal Anti-DLD Antibody - middle region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Carrier-free (BSA/glycerol-free) MAOA mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-MAOA Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOA

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB

Rabbit Polyclonal Anti-GATM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GATM antibody: synthetic peptide directed towards the middle region of human GATM. Synthetic peptide located within the following region: PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFKDPN

Rabbit Polyclonal antibody to CBS (cystathionine-beta-synthase)

Applications IF, IHC, IP, WB
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 251 of CBS (Uniprot ID#P35520)

Rabbit anti-DAO Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DAO

Rabbit anti-CBS Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CBS

Rabbit Polyclonal Anti-CBS Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen for anti-CBS antibody: synthetic peptide directed towards the N terminal of human CBS. Synthetic peptide located within the following region: RCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNE

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ

Rabbit Polyclonal antibody to Glycine dehydrogenase (glycine dehydrogenase (decarboxylating))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 442 and 723 of Glycine dehydrogenase (Uniprot ID#P23378)

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ALAS2

AGXT mouse monoclonal antibody, clone AT2T4, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

PHGDH mouse monoclonal antibody, clone 4A3-1D6, Purified

Applications ELISA, IF, IHC, IP, WB
Reactivities Human

Rabbit Polyclonal antibody to ALAS-E (aminolevulinate, delta-, synthase 2)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 211 and 587 of ALAS-E (Uniprot ID#P22557)

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK

AGXT mouse monoclonal antibody, clone AT2T4, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

CBSL mouse monoclonal antibody, clone 3E1, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human, Rat

Rabbit polyclonal antibody to PSPH (phosphoserine phosphatase)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 175 of PSPH (Uniprot ID#P78330)

Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%).

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the C terminal of human ALAS2. Synthetic peptide located within the following region: PTVPRGEELLRLAPSPHHSPQMMEDFVEKLLLAWTAVGLPLQDVSVAACN

Rabbit Polyclonal Anti-GAMT Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the N terminal of human GAMT. Synthetic peptide located within the following region: MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the C terminal of human ALAS2. Synthetic peptide located within the following region: VRLLKGEEGQALRRAHQRNVKHMRQLLMDRGLPVIPCPSHIIPIRVGNAA

CBSL mouse monoclonal antibody, clone 6B8, Purified

Applications ELISA, IHC, WB
Reactivities Human

CBSL mouse monoclonal antibody, clone 6A9, Purified

Applications ELISA, IHC, WB
Reactivities Human

CBSL mouse monoclonal antibody, clone 5F7, Purified

Applications ELISA, IHC, WB
Reactivities Human

GNMT mouse monoclonal antibody, clone AT5D1, Purified

Applications ELISA, IF, WB
Reactivities Human

GNMT mouse monoclonal antibody, clone AT5D1, Purified

Applications ELISA, IF, WB
Reactivities Human

Monoamine Oxidase A (MAOA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

GATM (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected between amino acids 70 and 100 of Human Glycine amidinotransferase

Goat Anti-PSPH Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-RQQVKDNAKWYITD, from the C-Terminus of the protein sequence according to NP_004568.2.

Anti-AGXT Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 280-294 amino acids of human alanine-glyoxylate aminotransferase

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV

Rabbit Polyclonal Anti-MAOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA

AGXT rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human AGXT

CBSL rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CBS

PHGDH (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human PHGDH

GLDC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 56~85 amino acids from the N-terminal region of Human GLDC

Goat Polyclonal Antibody against MAOB

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HKARKLARLTKEE, from the internal region of the protein sequence according to NP_000889.3.

Goat Polyclonal Antibody against Monoamine Oxidase A

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DAPWEAQHADKWDK, from the internal region of the protein sequence according to NP_000231.1.

Goat Anti-DAO / D-amino-acid oxidase (aa286-298) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RPQIRLEREQLRT, from the internal region of the protein sequence according to NP_001908.3.

Rabbit Polyclonal anti-GAMT antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GAMT antibody: synthetic peptide directed towards the middle region of human GAMT. Synthetic peptide located within the following region: PGEGPFLTPWVGWTVLVHLEIKVLCLAQWLPGAVAQVYNPSTVEGRGGQI

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Rabbit Polyclonal Anti-PHGDH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHGDH antibody: synthetic peptide directed towards the middle region of human PHGDH. Synthetic peptide located within the following region: SLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPA