Products

cDNA Clones (20)
Antibodies (19)
Proteins (17)
Jump to Filters
View as table Download
Livin (BIRC7) (NM_139317) Human Tagged ORF Clone
RC204906

USD 420.00

In Stock

BIRC7 (Myc-DDK-tagged)-Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Livin (BIRC7) (NM_022161) Human Tagged ORF Clone
RC215363

USD 420.00

In Stock

BIRC7 (Myc-DDK-tagged)-Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Livin (BIRC7) (NM_139317) Human Tagged ORF Clone Lentiviral Particle
RC204906L2V

USD 820.00

3 Weeks

Lenti ORF particles, BIRC7 (mGFP-tagged) - Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Livin (BIRC7) (NM_022161) Human Tagged ORF Clone Lentiviral Particle
RC215363L2V

USD 820.00

3 Weeks

Lenti ORF particles, BIRC7 (mGFP-tagged) - Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Livin (BIRC7) (NM_022161) Human Tagged ORF Clone
RG215363

USD 460.00

In Stock

BIRC7 (GFP-tagged) - Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Livin (BIRC7) (NM_139317) Human Tagged ORF Clone
RC204906L3

USD 620.00

3 Weeks

Lenti ORF clone of Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Livin (BIRC7) (NM_139317) Human Tagged ORF Clone Lentiviral Particle
RC204906L3V

USD 820.00

5 Weeks

Lenti ORF particles, BIRC7 (Myc-DDK tagged) - Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Livin (BIRC7) (NM_139317) Human Tagged ORF Clone
RC204906L4

USD 620.00

3 Weeks

Lenti ORF clone of Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Livin (BIRC7) (NM_139317) Human Tagged ORF Clone Lentiviral Particle
RC204906L4V

USD 820.00

5 Weeks

Lenti ORF particles, BIRC7 (mGFP-tagged) - Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Livin (BIRC7) (NM_022161) Human Tagged ORF Clone
RC215363L3

USD 620.00

3 Weeks

Lenti ORF clone of Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Livin (BIRC7) (NM_022161) Human Tagged ORF Clone Lentiviral Particle
RC215363L3V

USD 820.00

7 Weeks

Lenti ORF particles, BIRC7 (Myc-DDK tagged) - Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Livin (BIRC7) (NM_022161) Human Tagged ORF Clone
RC215363L4

USD 620.00

3 Weeks

Lenti ORF clone of Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Livin (BIRC7) (NM_022161) Human Tagged ORF Clone Lentiviral Particle
RC215363L4V

USD 820.00

5 Weeks

Lenti ORF particles, BIRC7 (mGFP-tagged) - Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Livin (BIRC7) (NM_139317) Human Tagged ORF Clone
RG204906

USD 460.00

3 Weeks

BIRC7 (GFP-tagged) - Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Livin (BIRC7) (NM_139317) Human Tagged ORF Clone
RC204906L1

USD 768.00

In Stock

Lenti ORF clone of Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Livin (BIRC7) (NM_139317) Human Untagged Clone
SC123167

USD 310.00

In Stock

BIRC7 (untagged)-Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Livin (BIRC7) Rabbit Polyclonal Antibody
TA332873

USD 275.00

3 Weeks

Rabbit anti-BIRC7 Polyclonal Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human BIRC7
Livin (BIRC7) (NM_022161) Human Tagged ORF Clone
RC215363L1

USD 620.00

3 Weeks

Lenti ORF clone of Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Livin (BIRC7) Rabbit Polyclonal Antibody
TA306089

USD 430.00

5 Days

Rabbit Polyclonal Livin Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Livin antibody was raised with a synthetic peptide corresponding to amino acids 264 to 280 of the short form and 281 to 298 of the long form of human Livin (1,3) This sequence is identical between a and b forms of the Livin proteins .
Livin (BIRC7) Rabbit Polyclonal Antibody
TA308543

USD 415.00

5 Days

Rabbit polyclonal antibody to ML-IAP (baculoviral IAP repeat-containing 7)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 241 of Livin (Uniprot ID#Q96CA5)
Livin (BIRC7) (NM_139317) Human Over-expression Lysate
LC403386

USD 121.00

In Stock

BIRC7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Livin (BIRC7) (NM_022161) Human Over-expression Lysate
LC411731

USD 121.00

In Stock

BIRC7 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Livin (BIRC7) Rabbit Polyclonal Antibody
TA308807

USD 415.00

5 Days

Rabbit Polyclonal antibody to Livin (baculoviral IAP repeat-containing 7)

Applications IF, IHC
Reactivities Human
Immunogen Recombinant fragment corresponding to a region within amino acids 13 and 242 of Livin (Uniprot ID#Q96CA5)
Livin (BIRC7) Rabbit Polyclonal Antibody
AP20649PU-N

USD 370.00

2 Weeks

Livin (BIRC7) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Livin (BIRC7) (NM_139317) Human Over-expression Lysate
LY403386

USD 396.00

5 Days

Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Livin (BIRC7) Goat Polyclonal Antibody
TA302674

USD 375.00

5 Days

Goat Polyclonal Antibody against LIVIN / BIRC7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RAPVRSRVRT, from the C Terminus of the protein sequence according to NP_647478.1; NP_071444.1.
Livin (BIRC7) Rabbit Polyclonal Antibody
TA330333

USD 375.00

5 Days

Rabbit Polyclonal Anti-BIRC7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BIRC7 antibody: synthetic peptide directed towards the middle region of human BIRC7. Synthetic peptide located within the following region: EERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTFL
Livin (BIRC7) Mouse Monoclonal Antibody [Clone ID: 88C570]
TA336400

USD 424.00

5 Days

Mouse Monoclonal Livin Antibody (88C570)

Applications WB
Reactivities Human
Conjugation Unconjugated
BIRC7 / LIVIN (1-298) Human Protein
AR03006PU-L

USD 1,105.00

2 Weeks

BIRC7 / LIVIN (1-298) human recombinant protein, 0.5 mg

Expression Host E. coli
BIRC7 / LIVIN (1-298) Human Protein
AR03006PU-N

USD 415.00

2 Weeks

BIRC7 / LIVIN (1-298) human recombinant protein, 0.1 mg

Expression Host E. coli
BIRC7 / LIVIN (1-280, His-tag) Human Protein
AR50241PU-N

USD 845.00

2 Weeks

BIRC7 / LIVIN (1-280, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
BIRC7 / LIVIN (1-280, His-tag) Human Protein
AR50241PU-S

USD 330.00

2 Weeks

BIRC7 / LIVIN (1-280, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Livin (BIRC7) Mouse Monoclonal Antibody [Clone ID: OTI1D12]
CF500758

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BIRC7 mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Livin (BIRC7) Mouse Monoclonal Antibody [Clone ID: OTI1B10]
CF500761

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) BIRC7 mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Livin (BIRC7) (NM_022161) Human Over-expression Lysate
LY411731

USD 396.00

5 Days

Transient overexpression lysate of baculoviral IAP repeat-containing 7 (BIRC7), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Livin (BIRC7) (NM_139317) Human Mass Spec Standard
PH304906

USD 2,055.00

3 Weeks

BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_647478)

Tag C-Myc/DDK
Expression Host HEK293
Livin (BIRC7) (NM_022161) Human Mass Spec Standard
PH315363

USD 2,055.00

3 Weeks

BIRC7 MS Standard C13 and N15-labeled recombinant protein (NP_071444)

Tag C-Myc/DDK
Expression Host HEK293
Livin (BIRC7) (NM_022161) Human Untagged Clone
SC305009

USD 660.00

4 Weeks

BIRC7 (untagged)-Human baculoviral IAP repeat containing 7 (BIRC7), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Livin (BIRC7) Rabbit Polyclonal Antibody
TA322202

USD 345.00

4 Weeks

Anti-BIRC7 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
Livin (BIRC7) Mouse Monoclonal Antibody [Clone ID: OTI1D12]
TA500758

USD 379.00

In Stock

Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Livin (BIRC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D12]
TA500758AM

USD 420.00

4 Weeks

Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin
Livin (BIRC7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D12]
TA500758BM

USD 420.00

4 Weeks

Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1D12 (formerly 1D12), HRP conjugated

Applications FC, IHC, WB
Reactivities Human
Conjugation HRP
Livin (BIRC7) Mouse Monoclonal Antibody [Clone ID: OTI1D12]
TA500758S

USD 159.00

In Stock

Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1D12 (formerly 1D12)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Livin (BIRC7) Mouse Monoclonal Antibody [Clone ID: OTI1B10]
TA500761

USD 379.00

In Stock

Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Livin (BIRC7) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B10]
TA500761AM

USD 420.00

4 Weeks

Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1B10 (formerly 1B10), Biotinylated

Applications FC, IF, WB
Reactivities Human
Conjugation Biotin
Livin (BIRC7) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1B10]
TA500761BM

USD 420.00

4 Weeks

Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1B10 (formerly 1B10), HRP conjugated

Applications FC, IF, WB
Reactivities Human
Conjugation HRP
Livin (BIRC7) Mouse Monoclonal Antibody [Clone ID: OTI1B10]
TA500761S

USD 159.00

2 Days

Anti-BIRC7 (Livin) mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated