Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit Polyclonal Antibody against MYC (S373)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MYC antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 351-380 amino acids from human MYC. |
Rabbit Polyclonal Antibody against GATA4 (C-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GATA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 298-328 amino acids from the C-terminal region of human GATA4. |
Goat Anti-SOX11 (aa309-323) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SRLYYSFKNITKQHP, from the internal region of the protein sequence according to NP_003099.1. |
Rabbit polyclonal anti-BMP-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed recombinant human BMP-6 |
Rabbit Polyclonal GATA4 (Ser262) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA4 around the phosphorylation site of Serine 262 |
| Modifications | Phospho-specific |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal Myc (Ser62) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Myc around the phosphorylation site of Serine 62 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-BMP5 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Bmp5 antibody is: synthetic peptide directed towards the C-terminal region of Rat Bmp5. Synthetic peptide located within the following region: NKSSSHQDPSRIPSAGDYNTSEQKQACKKHELYVSFRDLGWQDWIIAPEG |
Rabbit anti SOX-2 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of Human SOX-2 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Rabbit anti SOX-9 (pS181) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope –RKSVK- with a single phosphorylation site Ser181. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Rabbit anti SOX-9 (paired S181) Polyclonal Antibody
| Applications | Dot, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the epitope –RKSVK- without phosphorylation. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Goat Polyclonal Antibody against OCT4 / POU5F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VTTLGSPMHSN, from the C Terminus of the protein sequence according to NP_002692.2; NP_976034.2. |
Goat Polyclonal Antibody against KLF4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence AVSDALLPSFST-C, from the N Terminus of the protein sequence according to NP_004226. |
Rabbit anti-PDGFC polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Partial recombaint protein |
Goat Anti-NODAL Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ECPNPVGEEFH, from the internal region of the protein sequence according to NP_060525.2. |
Rabbit polyclonal anti-Transcription Factor 3 (E2A Immunoglobulin Enhancer Binding Factors E12/E47) antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human E2A. |
Rabbit polyclonal anti-Sox-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 322 of mouse Sox-1 |
Mouse Monoclonal KLF4 Monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal KLF4 Monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-BMP7 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BMP7 |
Rabbit Polyclonal SOX2 Antibody
| Applications | WB |
| Reactivities | Fish, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Reacts with residues 113-127 of the 37 kDa (predicted molecular weight is 34 kDa) human, mouse and rat SOX-2 protein. Sequence is 100% conserved in most species. |
Mouse Monoclonal GATA-4 Antibody (6H10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
TA336777 is a replacement of AM06352SU-N.
Rabbit anti FGF 4 (NT) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine. |
Rabbit anti FGF4 (IN) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the internal sequence of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine. |
Rabbit anti FGF4 (NT1) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine. |
Rabbit anti FGF4 (NT2) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the N-terminus of Fibroblast Growth Factor 4 protein. This sequence is identical to human, mouse, rat and bovine. |
Rabbit anti SOX-9 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal sequence of Human SOX-9 protein. This sequence is identical among human, rat, mouse, bovine, chicken, and dog. |
Carrier-free (BSA/glycerol-free) c-Myc mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD4 mouse monoclonal antibody, clone OTI9C1 (formerly 9C1)
| Applications | WB |
| Reactivities | Human, Monkey, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Rat
Families
- Induced pluripotent stem cells
Filter by
Category
Target Symbol
- PDX1 (37)
- MYC (32)
- BMP6 (23)
- KLF5 (22)
- BMP4 (20)
- OTX2 (20)
- SOX9 (20)
- CD4 (19)
- GATA4 (18)
- SOX2 (15)
- FOXA2 (10)
- POU5F1 (9)
- DPPA2 (7)
- BDNF (6)
- KLF4 (6)
- FGF4 (5)
- TCF3 (4)
- AXIN2 (3)
- BMP2 (3)
- DNMT3B (3)
- EGF (3)
- SOX1 (3)
- PDGFC (2)
- SOX11 (2)
- SOX7 (2)
- BMP5 (1)
- BMP7 (1)
- CD38 (1)
- GDF3 (1)
- NANOG (1)
- NODAL (1)
- SOX10 (1)
- SOX4 (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Pathways
- TGF-beta signaling pathway (81)
- Pathways in cancer (66)
- Hedgehog signaling pathway (48)
- Maturity onset diabetes of the young (47)
- MAPK signaling pathway (46)
- Endometrial cancer (38)
- Type II diabetes mellitus (37)
- Acute myeloid leukemia (35)
- Bladder cancer (35)
- Colorectal cancer (35)
- ErbB signaling pathway (35)
- Wnt signaling pathway (35)
- Cell cycle (32)
- Chronic myeloid leukemia (32)
- Jak-STAT signaling pathway (32)
- Small cell lung cancer (32)
- Thyroid cancer (32)
- Basal cell carcinoma (26)
- Hematopoietic cell lineage (23)
- Antigen processing and presentation (19)
- Cell adhesion molecules (CAMs) (19)
- Primary immunodeficiency (19)
- T cell receptor signaling pathway (19)
- Melanoma (10)
- Regulation of actin cytoskeleton (10)
- Cytokine-cytokine receptor interaction (9)
- Endocytosis (6)
- Huntington's disease (6)
- Neurotrophin signaling pathway (6)
- Focal adhesion (5)
- Gap junction (5)
- Prostate cancer (5)
- Metabolic pathways (4)
- Cysteine and methionine metabolism (3)
- Glioma (3)
- Melanogenesis (3)
- Non-small cell lung cancer (3)
- Pancreatic cancer (3)
- Calcium signaling pathway (1)
- Nicotinate and nicotinamide metabolism (1)