Products

cDNA Clones (35)
Proteins (31)
Antibodies (8)
Jump to Filters
View as table Download
RAGE (AGER) (NM_001136) Human Tagged ORF Clone
RC204664

USD 420.00

In Stock

AGER (Myc-DDK-tagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RAGE (AGER) (NM_172197) Human Tagged ORF Clone
RC220417

USD 420.00

In Stock

AGER (Myc-DDK-tagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
RAGE (AGER) (NM_001136) Human Untagged Clone
SC122583

USD 310.00

In Stock

AGER (untagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RAGE (AGER) (NM_001136) Human Tagged ORF Clone
RG204664

USD 460.00

In Stock

AGER (GFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001136) Human Tagged ORF Clone Lentiviral Particle
RC204664L1V

USD 820.00

3 Weeks

Lenti ORF particles, AGER (Myc-DDK tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
RAGE (AGER) (NM_001136) Human Tagged ORF Clone Lentiviral Particle
RC204664L2V

USD 820.00

3 Weeks

Lenti ORF particles, AGER (mGFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
RAGE (AGER) (NM_001206940) Human Tagged ORF Clone
RC233834

USD 420.00

In Stock

AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_172197) Human Tagged ORF Clone
RC220417L3

USD 620.00

3 Weeks

Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAGE (AGER) (NM_172197) Human Tagged ORF Clone Lentiviral Particle
RC220417L3V

USD 820.00

6 Weeks

Lenti ORF particles, AGER (Myc-DDK tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
RAGE (AGER) (NM_172197) Human Tagged ORF Clone
RC220417L4

USD 620.00

3 Weeks

Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAGE (AGER) (NM_172197) Human Tagged ORF Clone Lentiviral Particle
RC220417L4V

USD 820.00

6 Weeks

Lenti ORF particles, AGER (mGFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
RAGE (AGER) (NM_001206954) Human Tagged ORF Clone
RC232484

USD 420.00

3 Weeks

AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206936) Human Tagged ORF Clone
RC232565

USD 420.00

3 Weeks

AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206966) Human Tagged ORF Clone
RC233835

USD 420.00

5 Days

AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 9

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206934) Human Tagged ORF Clone
RC233880

USD 420.00

5 Weeks

AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206932) Human Tagged ORF Clone
RC233956

USD 420.00

5 Weeks

AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206929) Human Tagged ORF Clone
RC234046

USD 440.00

5 Weeks

AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_172197) Human Tagged ORF Clone
RG220417

USD 460.00

3 Weeks

AGER (GFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206954) Human Tagged ORF Clone
RG232484

USD 460.00

3 Weeks

AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206936) Human Tagged ORF Clone
RG232565

USD 460.00

3 Weeks

AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206940) Human Tagged ORF Clone
RG233834

USD 460.00

3 Weeks

AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206966) Human Tagged ORF Clone
RG233835

USD 460.00

5 Weeks

AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 9

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206934) Human Tagged ORF Clone
RG233880

USD 460.00

5 Weeks

AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206932) Human Tagged ORF Clone
RG233956

USD 460.00

5 Weeks

AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) (NM_001206929) Human Tagged ORF Clone
RG234046

USD 480.00

5 Weeks

AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
RAGE (AGER) Rabbit Polyclonal Antibody
TA346072

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-AGER Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT
RAGE (AGER) (NM_001136) Human Tagged ORF Clone
RC204664L1

USD 768.00

In Stock

Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
RAGE (AGER) Rabbit Polyclonal Antibody
TA349215

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human AGER
RAGE (AGER) (NM_001136) Human Tagged ORF Clone
RC204664L2

USD 620.00

In Stock

Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
RAGE (AGER) Rabbit Polyclonal Antibody
TA346144

USD 475.00

5 Days

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG
RAGE (AGER) Rabbit Polyclonal Antibody
TA346145

USD 410.00

5 Days

Rabbit Polyclonal Anti-AGER Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: RIRAGNSSPGPGDPGRPGDSRPAHWGHLVAKAATPRRGEEGPRKPGGRGG
RAGE (AGER) Rabbit Polyclonal Antibody
TA327041

USD 275.00

3 Weeks

Rabbit anti-AGER Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human AGER
RAGE (AGER) Rabbit Polyclonal Antibody
AP23365PU-N

USD 405.00

2 Weeks

RAGE (AGER) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence mapping in the middle region of Human advanced glycosylation end-product-specific receptor(RAGE), different from the related Mouse and Rat sequences by two amino acids.
RAGE (AGER) (NM_172197) Human Untagged Clone
SC306735

USD 580.00

In Stock

AGER (untagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
RAGE (AGER) Rabbit Polyclonal Antibody
TA324792

USD 450.00

5 Days

Rabbit polyclonal AGER Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This AGER antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human AGER.
RAGE (AGER) (NM_001206940) Human Untagged Clone
SC331712

USD 350.00

In Stock

AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 6

Vector PCMV6-Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
RAGE (AGER) Rabbit Polyclonal Antibody
TA324716

USD 450.00

5 Days

Rabbit polyclonal RAGE (AGER) Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RAGE (AGER) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 348-378 amino acids from the C-terminal region of human RAGE (AGER).
RAGE (AGER) (NM_001136) Human Over-expression Lysate
LC400460

USD 121.00

In Stock

AGER HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
RAGE (AGER) (NM_001136) Human Over-expression Lysate
LY400460

USD 396.00

5 Days

Transient overexpression lysate of advanced glycosylation end product-specific receptor (AGER), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAGE (AGER) (NM_172197) Human Over-expression Lysate
LC406771

USD 121.00

2 Weeks

AGER HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAGE (AGER) (NM_172197) Human Over-expression Lysate
LC430356

USD 121.00

2 Weeks

AGER HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAGE (AGER) (NM_172197) Human Over-expression Lysate
LY406771

USD 396.00

5 Days

Transient overexpression lysate of advanced glycosylation end product-specific receptor (AGER), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY406771 is the same product as LY430356.
RAGE (AGER) (NM_172197) Human Over-expression Lysate
LY430356

USD 396.00

5 Days

Transient overexpression lysate of advanced glycosylation end product-specific receptor (AGER), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
RAGE (AGER) (NM_001206936) Human Untagged Clone
SC329860

USD 360.00

3 Weeks

AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 5

Vector pCMV6 series
Tag Tag Free
RAGE (AGER) (NM_001206954) Human Untagged Clone
SC329863

USD 330.00

3 Weeks

AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 8

Vector pCMV6 series
Tag Tag Free
RAGE (AGER) (NM_001206929) Human Untagged Clone
SC331707

USD 420.00

5 Weeks

AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 2

Vector pCMV6 series
Tag Tag Free
RAGE (AGER) (NM_001206932) Human Untagged Clone
SC331709

USD 390.00

5 Weeks

AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 3

Vector pCMV6 series
Tag Tag Free
RAGE (AGER) (NM_001206934) Human Untagged Clone
SC331710

USD 370.00

5 Weeks

AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 4

Vector pCMV6 series
Tag Tag Free
RAGE (AGER) (NM_001206966) Human Untagged Clone
SC331723

USD 350.00

5 Weeks

AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 9

Vector pCMV6 series
Tag Tag Free
RAGE (AGER) ICC Control Block
TB404664

USD 1,070.00

4 Weeks

Transient overexpression of AGER (NM_001136) in HEK293T cells paraffin embedded controls for ICC/IHC staining