Products

Antibodies (22)
cDNA Clones (10)
Proteins (6)
Jump to Filters
View as table Download
HIF 2 alpha (EPAS1) (NM_001430) Human Tagged ORF Clone
RC208604

USD 420.00

In Stock

EPAS1 (Myc-DDK-tagged)-Human endothelial PAS domain protein 1 (EPAS1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HIF 2 alpha (EPAS1) (NM_001430) Human Over-expression Lysate
LY400555

USD 396.00

4 Weeks

Transient overexpression lysate of endothelial PAS domain protein 1 (EPAS1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HIF 2 alpha (EPAS1) (NM_001430) Human Untagged Clone
SC110883

USD 310.00

In Stock

EPAS1 (untagged)-Human endothelial PAS domain protein 1 (EPAS1)

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None
HIF 2 alpha (EPAS1) (NM_001430) Human Tagged ORF Clone
RG208604

USD 460.00

In Stock

EPAS1 (GFP-tagged) - Human endothelial PAS domain protein 1 (EPAS1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HIF 2 alpha (EPAS1) Rabbit Polyclonal Antibody
TA309641

USD 479.00

2 Weeks

Rabbit Polyclonal HIF-2 alpha Antibody

Applications IHC, WB
Reactivities Fish, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein.
HIF 2 alpha (EPAS1) (NM_001430) Human Untagged Clone
SC320566

USD 310.00

In Stock

EPAS1 (untagged)-Human endothelial PAS domain protein 1 (EPAS1)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
HIF 2 alpha (EPAS1) (NM_001430) Human Over-expression Lysate
LC400555

USD 121.00

2 Weeks

EPAS1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
HIF 2 alpha (EPAS1) (NM_001430) Human Tagged ORF Clone
RC208604L2

USD 620.00

3 Weeks

Lenti ORF clone of Human endothelial PAS domain protein 1 (EPAS1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
HIF 2 alpha (EPAS1) (N-term) Rabbit Polyclonal Antibody
AP51440PU-N

USD 450.00

2 Weeks

HIF 2 alpha (EPAS1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 127-154 amino acids from the N-terminal region of Human HIF2A
HIF 2 alpha (EPAS1) Rabbit Polyclonal Antibody
TA330214

USD 375.00

5 Days

Rabbit Polyclonal Anti-EPAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD
HIF 2 alpha (EPAS1) (NM_001430) Human Recombinant Protein
TP762188

USD 215.00

In Stock

Purified recombinant protein of Human endothelial PAS domain protein 1 (EPAS1), Leu584-end, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI2G5]
CF801746

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI2A6]
CF801749

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI6G3]
CF809645

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody,clone OTI6G3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI2A6]
TA801749

USD 379.00

In Stock

EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HIF 2 alpha (EPAS1) ICC Control Block
TB408604

USD 1,070.00

4 Weeks

Transient overexpression of EPAS1 (NM_001430) in HEK293T cells paraffin embedded controls for ICC/IHC staining

HIF 2 alpha (EPAS1) Cytosection
TS408604

USD 225.00

4 Weeks

Transient overexpression of EPAS1 (NM_001430) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

HIF 2 alpha (EPAS1) Cytosection
TS408604P5

USD 889.00

4 Weeks

Transient overexpression of EPAS1 (NM_001430) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack