AGER (Myc-DDK-tagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (Myc-DDK-tagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (Myc-DDK-tagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (untagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
AGER (GFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, AGER (Myc-DDK tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, AGER (mGFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AGER (Myc-DDK tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, AGER (mGFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 9
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (Myc-DDK tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
AGER (GFP-tagged) - Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 8
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 9
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
AGER (GFP-tagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-AGER Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the N terminal of human AGER. Synthetic peptide located within the following region: FLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELT |
Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-AGER Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AGER |
Lenti ORF clone of Human advanced glycosylation end product-specific receptor (AGER), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-AGER Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: PSPQIHWMKDVSDLERGAGRTRRGGANCRLCGRIRAGNSSPGPGDPGRPG |
Rabbit Polyclonal Anti-AGER Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AGER antibody: synthetic peptide directed towards the C terminal of human AGER. Synthetic peptide located within the following region: RIRAGNSSPGPGDPGRPGDSRPAHWGHLVAKAATPRRGEEGPRKPGGRGG |
Rabbit anti-AGER Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AGER |
RAGE (AGER) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping in the middle region of Human advanced glycosylation end-product-specific receptor(RAGE), different from the related Mouse and Rat sequences by two amino acids. |
AGER (untagged)-Human advanced glycosylation end product-specific receptor (AGER), transcript variant 7
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal AGER Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This AGER antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human AGER. |
AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 6
Vector | PCMV6-Neo |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal RAGE (AGER) Antibody (C-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This RAGE (AGER) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 348-378 amino acids from the C-terminal region of human RAGE (AGER). |
AGER HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Transient overexpression lysate of advanced glycosylation end product-specific receptor (AGER), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AGER HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AGER HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of advanced glycosylation end product-specific receptor (AGER), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of advanced glycosylation end product-specific receptor (AGER), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 8
Vector | pCMV6 series |
Tag | Tag Free |
AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
AGER (untagged) - Homo sapiens advanced glycosylation end product-specific receptor (AGER), transcript variant 9
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of AGER (NM_001136) in HEK293T cells paraffin embedded controls for ICC/IHC staining