Germany
Japan
United Kingdom
China
Products
Download
Anti-RHOA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 179-189 amino acids of Human ras homolog family member A |
Rabbit polyclonal anti-LAMA1 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA1. |
Rabbit Polyclonal Anti-MYLK Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLK Antibody: A synthesized peptide derived from human MYLK |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the N terminal of human ACTN2. Synthetic peptide located within the following region: NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSH |
Rabbit Polyclonal Anti-ACTN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN2 antibody: synthetic peptide directed towards the C terminal of human ACTN2. Synthetic peptide located within the following region: VIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALD |
Rabbit Polyclonal Anti-ACTN4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACTN4 antibody: synthetic peptide directed towards the N terminal of human ACTN4. Synthetic peptide located within the following region: LIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKMLDAEDIVNTA |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Anti-VTN Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VTN antibody: synthetic peptide directed towards the N terminal of human VTN. Synthetic peptide located within the following region: EDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEEE |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit polyclonal Filamin A (Ser2152) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Filamin A around the phosphorylation site of serine 2152 (A-P-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Human
Pathways
- Focal adhesion
Filter by
Target Symbol
- ERBB2 (227)
- MAP2K1 (225)
- JUN (182)
- EGFR (163)
- CTNNB1 (146)
- AKT1 (114)
- BRAF (99)
- VWF (99)
- BCL2 (95)
- PARVA (70)
- MAPK1 (69)
- PIK3CG (64)
- PDGFRA (56)
- MET (54)
- VEGFA (49)
- PIK3R5 (46)
- HRAS (45)
- BIRC3 (43)
- AKT2 (41)
- CCND2 (40)
- KDR (39)
- PDGFRB (39)
- PXN (39)
- LAMB3 (38)
- MAPK8 (38)
- SPP1 (37)
- VASP (37)
- PIK3CD (35)
- PARVB (32)
- HGF (31)
- CCND1 (30)
- FN1 (30)
- SHC1 (30)
- BCAR1 (29)
- ACTB (28)
- ITGB3 (28)
- MAPK9 (28)
- PTK2 (28)
- EGF (26)
- IGF1R (26)
- MYL7 (26)
- FLT4 (24)
- PIK3CA (24)
- RAPGEF1 (24)
- FLT1 (22)
- IGF1 (22)
- ITGB1 (22)
- PRKCA (22)
- VEGFB (22)
- VEGFD (22)
- RAF1 (21)
- PAK4 (20)
- CAV1 (18)
- MAPK10 (18)
- SRC (18)
- AKT3 (17)
- BAD (17)
- GSK3B (17)
- MAPK3 (17)
- ELK1 (15)
- PTEN (15)
- LAMA4 (14)
- PAK1 (13)
- ROCK2 (13)
- CAPN2 (12)
- ITGAV (12)
- VCL (12)
- ACTN1 (11)
- PRKCB (11)
- COL3A1 (10)
- FYN (10)
- ILK (10)
- PDGFB (10)
- PPP1CA (10)
- PIK3R1 (9)
- ITGA2 (8)
- ITGA4 (8)
- ITGA6 (8)
- MYL9 (8)
- PDPK1 (8)
- TNC (8)
- VAV1 (8)
- CAV2 (7)
- CCND3 (7)
- COL1A1 (7)
- FLNA (7)
- GRB2 (7)
- ITGA5 (7)
- PAK2 (7)
- PAK5 (7)
- PGF (7)
- PPP1CB (7)
- RHOA (7)
- VEGFC (7)
- ARHGAP5 (6)
- COL1A2 (6)
- COL5A2 (6)
- COL6A1 (6)
- ITGB4 (6)
- ITGB6 (6)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (3380)
- Protein Kinase (1546)
- ES Cell Differentiation/IPS (1331)
- Transmembrane (937)
- Secreted Protein (578)
- Transcription Factors (356)
- Adult stem cells (224)
- Stem cell - Pluripotency (222)
- Stem cell relevant signaling - JAK/STAT signaling pathway (211)
- Cancer stem cells (163)
- Protease (43)
- Phosphatase (36)
- Embryonic stem cells (30)
- Induced pluripotent stem cells (30)
- Stem cell relevant signaling - DSL/Notch pathway (30)
- Stem cell relevant signaling - Wnt Signaling pathway (30)