Germany
Japan
United Kingdom
China
Products
Rabbit Polyclonal Anti-PDGFB Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDGFB antibody: synthetic peptide directed towards the N terminal of human PDGFB. Synthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD |
Rabbit Polyclonal Anti-TCF7L1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: ESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYPG |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal p21 Cip1 (Thr145) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p21 Cip1 around the phosphorylation site of Threonine 145 |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
ATF4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ATF4 |
Rabbit Polyclonal Anti-CREB3L1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CREB3L1 antibody: synthetic peptide directed towards the N terminal of human CREB3L1. Synthetic peptide located within the following region: MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFTENMEDF |
Rabbit Polyclonal Anti-P300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P300/CBP Antibody: A synthesized peptide derived from human P300/CBP |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
PDGF beta (PDGFB) (PDGF-BB) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (>98%) Recombinant Human PDGF-B. |
Rabbit Polyclonal Antibody against BRAF (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit anti-MTOR polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman mTOR around the phosphorylation site of serine 2448 (T-D-SP-Y-S). |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal Androgen Receptor (Ab-650) antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Androgen Receptor around the phosphorylation site of serine 650 (T-T-SP-P-T). |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal CREB (Ser133) Antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human CREB around the phosphorylation site of Sersine 133. |
| Modifications | Phospho-specific |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Phospho-IGF1R-Y1161 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y1161 of human IGF1R |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Prostate cancer
Filter by
Target Symbol
- TP53 (255)
- ERBB2 (239)
- MAP2K1 (237)
- EGFR (207)
- CTNNB1 (162)
- AKT1 (127)
- MDM2 (121)
- NKX3-1 (115)
- BCL2 (105)
- BRAF (100)
- MAPK1 (74)
- MTOR (72)
- FGFR2 (66)
- FOXO1 (65)
- PIK3CG (64)
- CDK2 (63)
- PDGFRA (63)
- KLK3 (62)
- RB1 (59)
- KRAS (58)
- RELA (54)
- PDGFRB (50)
- AR (49)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- FGFR1 (43)
- IKBKG (41)
- EGF (38)
- CCND1 (37)
- CDKN1A (36)
- NFKB1 (36)
- PIK3CD (35)
- MAP2K2 (34)
- RAF1 (33)
- CREB1 (32)
- IGF1 (31)
- NFKBIA (30)
- ATF4 (29)
- HSP90AB1 (29)
- IGF1R (29)
- CASP9 (26)
- CHUK (26)
- PIK3CA (25)
- ARAF (24)
- HSP90AA1 (24)
- GSTP1 (23)
- MAPK3 (23)
- PTEN (23)
- BAD (21)
- GSK3B (20)
- IKBKB (20)
- AKT3 (19)
- INS (18)
- NRAS (17)
- CDKN1B (16)
- PDGFB (16)
- HSP90B1 (15)
- PIK3R1 (14)
- CCNE1 (12)
- E2F1 (12)
- EP300 (12)
- GRB2 (11)
- LEF1 (11)
- PDGFA (11)
- E2F2 (9)
- PDPK1 (9)
- TCF7 (9)
- CREBBP (7)
- CCNE2 (6)
- PDGFD (6)
- TGFA (6)
- PDGFC (5)
- SRD5A2 (5)
- CREB3 (4)
- CREB3L1 (4)
- CREB3L2 (4)
- PIK3CB (4)
- PIK3R3 (4)
- TCF7L2 (4)
- CREB3L4 (3)
- E2F3 (3)
- SOS2 (3)
- TCF7L1 (3)
- B RAF (2)
- CASPASE 9 (2)
- PIK3R2 (2)
- SOS1 (2)
- CREB5 (1)
Reactivities
- Human (3275)
- Mouse (2472)
- Rat (2350)
- Monkey (526)
- Dog (432)
- Bovine (28)
- Chicken (23)
- Pig (22)
- Cow (15)
- Rabbit (14)
- Canine (11)
- Primate (10)
- Xenopus (10)
- Hamster (6)
- Drosophila (4)
- Porcine (4)
- Rhesus Monkey (4)
- Zebrafish (3)
- Canis (2)
- Chimpanzee (2)
- Feline (2)
- Frog (2)
- Gerbil (2)
- Guinea Pig (2)
- Horse (2)
- Sheep (2)
- Bat (1)
- Equine (1)
- Fungi (1)
- Insect (1)
- Plant (1)
- X. tropicalis (1)
- Yeast (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (3616)
- Protein Kinase (1624)
- Transcription Factors (1129)
- ES Cell Differentiation/IPS (976)
- Transmembrane (851)
- Stem cell - Pluripotency (466)
- Secreted Protein (396)
- Adult stem cells (261)
- Stem cell relevant signaling - JAK/STAT signaling pathway (244)
- Cancer stem cells (207)
- Protease (90)
- Nuclear Hormone Receptor (49)
- Stem cell relevant signaling - DSL/Notch pathway (49)
- Embryonic stem cells (43)
- Induced pluripotent stem cells (43)
- Stem cell relevant signaling - Wnt Signaling pathway (37)
- Phosphatase (23)