Germany
Japan
United Kingdom
China
Products
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Mouse anti-PROM1 (CD133) monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
Anti-LGR5 mouse mAb, clone OTI2A2, bionylated
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal Anti-GRSF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRSF1 antibody: synthetic peptide directed towards the middle region of human GRSF1. Synthetic peptide located within the following region: IRNGENGIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEV |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
USD 479.00
2 Weeks
Rabbit Polyclonal IRAK-M Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | IRAK-M antibody was raised against a peptide corresponding to 16 amino acids near the carboxy terminus of human IRAK-M. The immunogen is located within the last 50 amino acids of IRAK-M. |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
YB-1/YBX1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human YB-1/YB-1/YBX1 (NP_004550.2). |
| Modifications | Unmodified |
USD 399.00
In Stock
Active filters
Reactivities
- Human
Filter by
Target Symbol
- ALK (283)
- VSNL1 (277)
- TP53 (262)
- KLK8 (257)
- ERBB2 (244)
- MAP2K1 (241)
- CD4 (236)
- PDCD1 (221)
- EGFR (210)
- CD5 (205)
- CDKN2A (205)
- JUN (197)
- GFAP (180)
- PGR (175)
- NME1 (174)
- ABCB1 (170)
- MKI67 (168)
- ERCC1 (160)
- CTNNB1 (159)
- MAP2K3 (159)
- GLI1 (155)
- UCHL1 (155)
- KRT19 (148)
- PECAM1 (148)
- VIM (146)
- NBN (144)
- CD274 (142)
- IL6 (141)
- TG (137)
- CD68 (136)
- LIPG (136)
- AKT1 (134)
- GADD45G (134)
- CTAG1B (132)
- HAVCR2 (132)
- MSMB (129)
- OTC (129)
- CD40 (127)
- PCNA (125)
- CD99 (124)
- MDM2 (122)
- APP (121)
- LCN2 (120)
- AFP (115)
- NKX3-1 (115)
- CD44 (113)
- NUMB (112)
- PIK3C2A (112)
- ADIPOQ (111)
- IL1RL1 (111)
- CD80 (110)
- CFI (107)
- LGALS3 (107)
- BCL2 (106)
- BRAF (106)
- EPCAM (106)
- MAPT (106)
- CD63 (105)
- TOP2A (104)
- IL17A (103)
- CD47 (102)
- VWF (102)
- CTLA4 (100)
- KRT20 (100)
- MAPK13 (100)
- MLANA (99)
- F13A1 (97)
- L1CAM (97)
- UBE2E3 (97)
- TNFRSF8 (96)
- SENP2 (95)
- MS4A1 (93)
- PTPRC (93)
- BTLA (92)
- NKX2-1 (92)
- CD33 (91)
- TYMS (90)
- MLH1 (87)
- MPO (87)
- PNMT (87)
- S100A8/A9 (87)
- MAPK1 (86)
- CHGA (85)
- KIT (85)
- LGR5 (85)
- MIEN1 (85)
- SAA1 (85)
- STAT5A (82)
- D-DIMER (81)
- MDM4 (81)
- NPPB (80)
- SQSTM1 (80)
- CD19 (79)
- CD27 (79)
- PDCD1LG2 (79)
- NCAM1 (78)
- TACC2 (78)
- ALDH1L1 (77)
- FGF21 (77)
- CDH1 (76)
Species
Applications
Antibody Hosts
Isotypes
- IgG (54041)
- IgG1 (46267)
- IgG2a (11204)
- IgG2b (10049)
- IgG1, kappa (523)
- IgG, kappa (272)
- Ig (255)
- IgG3 (207)
- IgG2a, kappa (118)
- IgG2b, kappa (89)
- IgM (89)
- IgY (54)
- IgG1, lambda (27)
- IgG2c (21)
- Fab fragment, kappa (19)
- IgM, kappa (18)
- IgG3, kappa (17)
- IgG4 (10)
- IgG2a, lambda (3)
- IgG2 (2)
- IgG2, kappa (2)
- scFv (2)
- F(ab)2, kappa (1)
- IgA (1)
- IgG fraction (1)
- IgG1/IgK (1)
- IgG12b (1)
- IgG2, alpha (1)
- IgG2b, lambda (1)
- IgG3/IgG1 (1)
- cocktail (1)
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (8100)
- Phospho-specific (1397)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (80)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (26)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (20)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (19)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. (17)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (15)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (13)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (13)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (7)
- Phospho S83 (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (6)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (6)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (5)
- This full-length, reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (5)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (5)
- Acetyl K5 (4)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (4)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (4)
- Modification (3)
- Phospho S15 (3)
- Phospho S166 (3)
- Phospho S376 (3)
- Phospho T286 (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgM format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- Acetyl K4 (2)
- MonoMethyl K342 (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S128 (2)
- Phospho S129 (2)
- Phospho S139 (2)
- Phospho S16 (2)
- Phospho S176/180 (2)
- Phospho S21 (2)
- Phospho S319 (2)
- Phospho S345 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S396 (2)
- Phospho S56 (2)
- Phospho S616 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- Phospho S89 (2)
- Phospho S9 (2)
- Phospho T183/T172 (2)
- Phospho T187 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- Phospho Y410 (2)
- Phospho Y779 (2)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This full-length, chimeric mouse antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- This full-length, reformatted human antibody was made using the variable domain sequences of the original Human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K262/K265/K274 (1)
- Acetyl K29 (1)
- Acetyl K332 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This reformatted human antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho 180/Y182,Phospho T180/Y182,Phospho T180/Y182,Phospho T183/Y1845 (1)
- Phospho Phospho S87 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S102 (1)
- Phospho S1033 (1)
- Phospho S11 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S1387 (1)
- Phospho S1490 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S194 (1)
- Phospho S1943 (1)
- Phospho S1981 (1)
- Phospho S199/S204 (1)
- Phospho S2 (1)
- Phospho S20 (1)
- Phospho S202 (1)
- Phospho S2056 (1)
- Phospho S209 (1)
- Phospho S211 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S22 (1)
- Phospho S235/236 (1)
- Phospho S240/244 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S2481 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S259 (1)
- Phospho S271 (1)
- Phospho S271/T275 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S296 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S304 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S32 (1)
- Phospho S32/S36 (1)
- Phospho S320 (1)
- Phospho S323 (1)
- Phospho S326 (1)
- Phospho S33 (1)
- Phospho S33/35 (1)
- Phospho S33/S37/T41 (1)
- Phospho S330 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S36 (1)
- Phospho S365 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S409/S410 (1)
- Phospho S412 (1)
- Phospho S420 (1)
- Phospho S422 (1)
- Phospho S423/S425 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S445 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S465/S467 (1)
- Phospho S467 (1)
- Phospho S471/472 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S483 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S507 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S519/T522 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S555 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S6 (1)
- Phospho S608 (1)
- Phospho S611/615 (1)
- Phospho S611/615/616 (1)
- Phospho S612 (1)
- Phospho S615 (1)
- Phospho S62 (1)
- Phospho S621 (1)
- Phospho S63 (1)
- Phospho S636/639 (1)
- Phospho S637 (1)
- Phospho S638 (1)
- Phospho S641 (1)
- Phospho S643/676 (1)
- Phospho S645 (1)
- Phospho S65 (1)
- Phospho S657/Y658 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S675 (1)
- Phospho S7 (1)
- Phospho S70 (1)
- Phospho S71 (1)
- Phospho S728 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S757 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S811 (1)
- Phospho S82 (1)
- Phospho S838/S840 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S890 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S916 (1)
- Phospho S932 (1)
- Phospho S957 (1)
- Phospho S967 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser551 (1)
- Phospho Ser729 (1)
- Phospho Ser792 (1)
- Phospho Ser90 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T1462 (1)
- Phospho T156 (1)
- Phospho T163 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T180/Y182 + T183/Y1845 (1)
- Phospho T181 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T184/T187 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T199 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T202/Y204+T185/Y187 (1)
- Phospho T204 (1)
- Phospho T210 (1)
- Phospho T212 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T231/S232 (1)
- Phospho T232 (1)
- Phospho T235 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T246 (1)
- Phospho T261 (1)
- Phospho T288 (1)
- Phospho T288,Phospho T232,Phospho T198 (1)
- Phospho T292 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T346 (1)
- Phospho T357/S358/S360 (1)
- Phospho T359 (1)
- Phospho T359/S363 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T434 (1)
- Phospho T446 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T505 (1)
- Phospho T508/T505 (1)
- Phospho T538 (1)
- Phospho T543 (1)
- Phospho T56 (1)
- Phospho T567,Phospho T564,Phospho T558 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T642 (1)
- Phospho T669 (1)
- Phospho T678 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T696 (1)
- Phospho T70 (1)
- Phospho T81 (1)
- Phospho T845 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T93 (1)
- Phospho T982 (1)
- Phospho Thr212/Ser214 (1)
- Phospho Thr421 (1)
- Phospho Y10 (1)
- Phospho Y1007 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1008 (1)
- Phospho Y1018 (1)
- Phospho Y1020 (1)
- Phospho Y1021 (1)
- Phospho Y1022/1023 (1)
- Phospho Y1045 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1068 (1)
- Phospho Y1070 (1)
- Phospho Y1086 (1)
- Phospho Y1096 (1)
- Phospho Y1148 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1173 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1217 (1)
- Phospho Y1221/1222 (1)
- Phospho Y1234/1235 (1)
- Phospho Y1248 (1)
- Phospho Y1284 (1)
- Phospho Y133 (1)
- Phospho Y1349 (1)
- Phospho Y1361 (1)
- Phospho Y138 (1)
- Phospho Y139 (1)
- Phospho Y14 (1)
- Phospho Y145 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y171 (1)
- Phospho Y177 (1)
- Phospho Y182 (1)
- Phospho Y191 (1)
- Phospho Y204 (1)
- Phospho Y207 (1)
- Phospho Y216 (1)
- Phospho Y221 (1)
- Phospho Y232 (1)
- Phospho Y245 (1)
- Phospho Y284 (1)
- Phospho Y291 (1)
- Phospho Y292 (1)
- Phospho Y307 (1)
- Phospho Y311 (1)
- Phospho Y317 (1)
- Phospho Y322 (1)
- Phospho Y323 (1)
- Phospho Y340 (1)
- Phospho Y353 (1)
- Phospho Y397 (1)
- Phospho Y402 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y416/Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y564 (1)
- Phospho Y576/577 (1)
- Phospho Y589/591 (1)
- Phospho Y594 (1)
- Phospho Y653 (1)
- Phospho Y659 (1)
- Phospho Y674/675 + Y706/707 (1)
- Phospho Y694 (1)
- Phospho Y699 (1)
- Phospho Y700 (1)
- Phospho Y705 (1)
- Phospho Y708 (1)
- Phospho Y719 (1)
- Phospho Y723 (1)
- Phospho Y724 (1)
- Phospho Y731 (1)
- Phospho Y751 (1)
- Phospho Y754 (1)
- Phospho Y759 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y845 (1)
- Phospho Y849 (1)
- Phospho Y869 (1)
- Phospho Y925 (1)
- Phospho Y980/981 (1)
- Phospho Y992 (1)
- Phospho Y996 (1)
- Phospho Y998 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Phospho-RPS6KB1-S371 (1)
- This chimeric human antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric murine antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (1)
- This full-length, chimeric mouse antibody was made using the variable domain sequences of the original Chicken scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Chicken scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric mouse antibody, based on the original rat IgG2b format, created for improved compatibility with existing reagents, assays and techniques. (1)
- This is a reformatted human IgG1 antibody based on the therapeutic Fab fragment. NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (1)
- This reformatted antibody was made using the variable domain sequences of the original mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original mouse scFv format for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- Ubiquityl K119 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
- monoMethyl E105 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- phospho S76 (1)
- phospho T1079,Phospho T1041 (1)
- succinylation K79 (1)
Assay Types
Assay Platforms
Families
- Druggable Genome (58886)
- Transmembrane (21997)
- Transcription Factors (16617)
- Secreted Protein (9532)
- ES Cell Differentiation/IPS (7422)
- Protein Kinase (6550)
- Protease (4213)
- Stem cell - Pluripotency (3792)
- Adult stem cells (1819)
- GPCR (1304)
- Nuclear Hormone Receptor (1257)
- Embryonic stem cells (1239)
- Phosphatase (1041)
- Cancer stem cells (900)
- Induced pluripotent stem cells (686)
- Ion Channels: Other (575)
- Stem cell relevant signaling - JAK/STAT signaling pathway (570)
- Stem cell relevant signaling - DSL/Notch pathway (535)
- P450 (467)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (274)
- Ion Channels: Potassium (209)
- Stem cell relevant signaling - Wnt Signaling pathway (163)
- Ion Channels: Cys-loop Receptors (142)
- Ion Channels: Transient receptor potential (127)
- Ion Channels: Glutamate Receptors (76)
- Ion Channels: Sodium (42)
- Ion Channels: ATP Receptors (25)
- Ion Channels: Calcium (17)
- Ion Channels: Cyclic nucleotide gated (17)
Pathways
- Metabolic pathways (8687)
- Pathways in cancer (7202)
- MAPK signaling pathway (4570)
- Focal adhesion (3596)
- Cytokine-cytokine receptor interaction (3381)
- Prostate cancer (3275)
- T cell receptor signaling pathway (2990)
- Neurotrophin signaling pathway (2842)
- Cell adhesion molecules (CAMs) (2719)
- Colorectal cancer (2708)
- Toll-like receptor signaling pathway (2683)
- Pancreatic cancer (2551)
- Regulation of actin cytoskeleton (2505)
- ErbB signaling pathway (2493)
- Melanoma (2436)
- Chronic myeloid leukemia (2388)
- Cell cycle (2347)
- Glioma (2259)
- Hematopoietic cell lineage (2235)
- Non-small cell lung cancer (2194)
- Endometrial cancer (2191)
- Bladder cancer (2177)
- Jak-STAT signaling pathway (2161)
- Insulin signaling pathway (2143)
- Chemokine signaling pathway (2115)
- Progesterone-mediated oocyte maturation (2115)
- B cell receptor signaling pathway (2103)
- Endocytosis (2059)
- Apoptosis (1933)
- Wnt signaling pathway (1834)
- GnRH signaling pathway (1805)
- Acute myeloid leukemia (1778)
- Fc epsilon RI signaling pathway (1776)
- Natural killer cell mediated cytotoxicity (1747)
- Leukocyte transendothelial migration (1745)
- Small cell lung cancer (1742)
- Renal cell carcinoma (1726)
- Alzheimer's disease (1666)
- p53 signaling pathway (1633)
- VEGF signaling pathway (1540)
- Fc gamma R-mediated phagocytosis (1536)
- Calcium signaling pathway (1494)
- Adherens junction (1478)
- Huntington's disease (1468)
- Gap junction (1412)
- Oocyte meiosis (1407)
- Purine metabolism (1401)
- Ubiquitin mediated proteolysis (1392)
- Amyotrophic lateral sclerosis (ALS) (1370)
- Neuroactive ligand-receptor interaction (1358)
- Melanogenesis (1314)
- Adipocytokine signaling pathway (1290)
- Thyroid cancer (1257)
- Epithelial cell signaling in Helicobacter pylori infection (1244)
- NOD-like receptor signaling pathway (1140)
- Axon guidance (1133)
- Tight junction (1129)
- mTOR signaling pathway (1103)
- Pyrimidine metabolism (1084)
- Parkinson's disease (1031)
- Vascular smooth muscle contraction (1025)
- Type II diabetes mellitus (1006)
- Systemic lupus erythematosus (1003)
- Long-term depression (997)
- RIG-I-like receptor signaling pathway (986)
- Primary immunodeficiency (984)
- Long-term potentiation (982)
- Complement and coagulation cascades (974)
- TGF-beta signaling pathway (959)
- Basal cell carcinoma (945)
- Pathogenic Escherichia coli infection (908)
- Antigen processing and presentation (883)
- Hypertrophic cardiomyopathy (HCM) (879)
- Glycolysis / Gluconeogenesis (867)
- Prion diseases (853)
- Lysosome (815)
- Viral myocarditis (800)
- Autoimmune thyroid disease (789)
- Arginine and proline metabolism (784)
- Cytosolic DNA-sensing pathway (783)
- Dilated cardiomyopathy (768)
- ECM-receptor interaction (765)
- PPAR signaling pathway (735)
- Nucleotide excision repair (685)
- Oxidative phosphorylation (662)
- Dorso-ventral axis formation (659)
- Hedgehog signaling pathway (651)
- Graft-versus-host disease (647)
- Allograft rejection (634)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (632)
- Type I diabetes mellitus (625)
- Spliceosome (622)
- Valine (620)
- leucine and isoleucine degradation (591)
- Proteasome (563)
- Phosphatidylinositol signaling system (554)
- Drug metabolism - cytochrome P450 (540)
- Glycerolipid metabolism (537)
- Tryptophan metabolism (533)
- Metabolism of xenobiotics by cytochrome P450 (527)
- Arachidonic acid metabolism (522)
- RNA degradation (520)
- Olfactory transduction (501)
- Lysine degradation (493)
- Notch signaling pathway (490)
- Pyruvate metabolism (485)
- Fatty acid metabolism (475)
- Inositol phosphate metabolism (459)
- Tyrosine metabolism (456)
- Propanoate metabolism (450)
- Alanine (448)
- aspartate and glutamate metabolism (448)
- Glutathione metabolism (431)
- DNA replication (430)
- Histidine metabolism (419)
- Mismatch repair (412)
- Base excision repair (405)
- Vibrio cholerae infection (404)
- Butanoate metabolism (391)
- One carbon pool by folate (389)
- Cardiac muscle contraction (377)
- ABC transporters (355)
- Retinol metabolism (354)
- beta-Alanine metabolism (338)
- Glycine (337)
- serine and threonine metabolism (337)
- Drug metabolism - other enzymes (334)
- Maturity onset diabetes of the young (326)
- Fructose and mannose metabolism (325)
- Asthma (314)
- Homologous recombination (313)
- Cysteine and methionine metabolism (308)
- Ribosome (299)
- Renin-angiotensin system (297)
- Amino sugar and nucleotide sugar metabolism (294)
- Starch and sucrose metabolism (287)
- Regulation of autophagy (260)
- Citrate cycle (TCA cycle) (259)
- Glycerophospholipid metabolism (257)
- Circadian rhythm - mammal (235)
- Linoleic acid metabolism (233)
- SNARE interactions in vesicular transport (230)
- Nicotinate and nicotinamide metabolism (229)
- Pentose phosphate pathway (223)
- Porphyrin and chlorophyll metabolism (219)
- Sphingolipid metabolism (219)
- Aminoacyl-tRNA biosynthesis (188)
- Nitrogen metabolism (187)
- RNA polymerase (180)
- Basal transcription factors (178)
- Galactose metabolism (177)
- Terpenoid backbone biosynthesis (177)
- Non-homologous end-joining (164)
- N-Glycan biosynthesis (161)
- Ascorbate and aldarate metabolism (159)
- Androgen and estrogen metabolism (158)
- Folate biosynthesis (158)
- Taste transduction (155)
- Primary bile acid biosynthesis (148)
- Phenylalanine metabolism (146)
- Other glycan degradation (138)
- Methane metabolism (134)
- Caffeine metabolism (133)
- Selenoamino acid metabolism (131)
- Sulfur metabolism (131)
- Ether lipid metabolism (129)
- Fatty acid elongation in mitochondria (127)
- Glyoxylate and dicarboxylate metabolism (126)
- Limonene and pinene degradation (102)
- Glycosaminoglycan degradation (95)
- Synthesis and degradation of ketone bodies (95)
- Cyanoamino acid metabolism (88)
- Biosynthesis of unsaturated fatty acids (82)
- Thiamine metabolism (81)
- C21-Steroid hormone metabolism (74)
- Riboflavin metabolism (74)
- Pantothenate and CoA biosynthesis (70)
- Pentose and glucuronate interconversions (70)
- Glycosphingolipid biosynthesis - lacto and neolacto series (61)
- Keratan sulfate biosynthesis (56)
- alpha-Linolenic acid metabolism (56)
- Fatty acid biosynthesis (49)
- Glycosphingolipid biosynthesis - ganglio series (48)
- Taurine and hypotaurine metabolism (45)
- O-Glycan biosynthesis (44)
- Steroid biosynthesis (44)
- Vitamin B6 metabolism (43)
- leucine and isoleucine biosynthesis (39)
- Glycosphingolipid biosynthesis - globo series (36)
- Heparan sulfate biosynthesis (33)
- Phenylalanine (32)
- tyrosine and tryptophan biosynthesis (32)
- Chondroitin sulfate biosynthesis (30)
- D-Glutamine and D-glutamate metabolism (27)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (23)
- Protein export (23)
- Ubiquinone and other terpenoid-quinone biosynthesis (12)
- Lysine biosynthesis (11)
- Lipoic acid metabolism (6)
- Biotin metabolism (5)
- O-Mannosyl glycan biosynthesis (4)
- D-Arginine and D-ornithine metabolism (2)