Germany
Japan
United Kingdom
China
PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, PKMYT1 (Myc-DDK tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PKMYT1 (mGFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (GFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PKMYT1 (mGFP-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PKMYT1 (mGFP-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PKMYT1 (Myc-DDK tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PKMYT1 (mGFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PKMYT1 (Myc-DDK tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (Myc-DDK tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (GFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (GFP-tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (GFP-tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PKMYT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PKMYT1 (untagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of PKMYT1 (NM_182687) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression lysate of protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PKMYT1 (untagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PKMYT1 (untagged)-Kinase deficient mutant (K139M) of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal MYT1 (Ser83) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Myt1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS |
PKMYT1 MS Standard C13 and N15-labeled recombinant protein (NP_004194)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
PKMYT1 (untagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
PKMYT1 (untagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 4
| Vector | pCMV6 series |
| Tag | Tag Free |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of PKMYT1 (NM_004203) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PKMYT1 (NM_001258450) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Active filters
Target Symbol
- PKMYT1
Pathways
- Cell cycle