Germany
Japan
United Kingdom
China
BHMT (Myc-DDK-tagged)-Human betaine--homocysteine S-methyltransferase (BHMT)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human betaine-homocysteine methyltransferase (BHMT)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, BHMT (Myc-DDK tagged) - Human betaine--homocysteine S-methyltransferase (BHMT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, BHMT (mGFP-tagged) - Human betaine--homocysteine S-methyltransferase (BHMT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
BHMT (GFP-tagged) - Human betaine--homocysteine S-methyltransferase (BHMT)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human betaine--homocysteine S-methyltransferase (BHMT), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BHMT (Myc-DDK tagged) - Human betaine--homocysteine S-methyltransferase (BHMT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human betaine--homocysteine S-methyltransferase (BHMT), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, BHMT (mGFP-tagged) - Human betaine--homocysteine S-methyltransferase (BHMT), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE |
Rabbit Polyclonal Anti-BHMT Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT |
Rabbit anti-BHMT Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BHMT |
Transient overexpression lysate of betaine-homocysteine methyltransferase (BHMT)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
BHMT HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF clone of Human betaine--homocysteine S-methyltransferase (BHMT), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human betaine--homocysteine S-methyltransferase (BHMT), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
BHMT (untagged)-Human betaine--homocysteine S-methyltransferase (BHMT)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
BHMT mouse monoclonal antibody, clone 3D6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BHMT mouse monoclonal antibody, clone 3D6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BHMT (His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
BHMT (His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
BHMT MS Standard C13 and N15-labeled recombinant protein (NP_001704)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Transient overexpression of BHMT (NM_001713) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of BHMT (NM_001713) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of BHMT (NM_001713) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- BHMT
Pathways
- Cysteine and methionine metabolism