Products

cDNA Clones (37)
Antibodies (29)
RNAi (12)
Proteins (10)
Gene Expression (7)
Jump to Filters
View as table Download
BHMT (NM_001713) Human Tagged ORF Clone
RC203148

USD 420.00

In Stock

BHMT (Myc-DDK-tagged)-Human betaine--homocysteine S-methyltransferase (BHMT)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Bhmt (BC093510) Mouse Tagged ORF Clone
MR206398

USD 240.00

In Stock

Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:103142 IMAGE:5101184)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BHMT (NM_001713) Human Tagged ORF Clone Lentiviral Particle
RC203148L1V

USD 820.00

3 Weeks

Lenti ORF particles, BHMT (Myc-DDK tagged) - Human betaine--homocysteine S-methyltransferase (BHMT), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
BHMT (NM_001713) Human Tagged ORF Clone Lentiviral Particle
RC203148L2V

USD 820.00

6 Weeks

Lenti ORF particles, BHMT (mGFP-tagged) - Human betaine--homocysteine S-methyltransferase (BHMT), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Bhmt (NM_016668) Mouse Tagged ORF Clone
MG206402

USD 470.00

In Stock

Bhmt (GFP-tagged) - Mouse betaine-homocysteine methyltransferase (Bhmt)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Bhmt (NM_016668) Mouse Tagged ORF Clone
MR206402

USD 430.00

In Stock

Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (Bhmt)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
BHMT (NM_001713) Human Tagged ORF Clone
RG203148

USD 460.00

In Stock

BHMT (GFP-tagged) - Human betaine--homocysteine S-methyltransferase (BHMT)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
BHMT Human Gene Knockout Kit (CRISPR)
KN403148

USD 1,290.00

2 Weeks

BHMT - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN403148 is the updated version of KN203148.
Bhmt Mouse Gene Knockout Kit (CRISPR)
KN502161

USD 1,290.00

2 Weeks

Bhmt - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN502161 is the updated version of KN302161.
Bhmt (BC093510) Mouse Tagged ORF Clone
MG206398

USD 260.00

3 Weeks

Bhmt (GFP-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:103142 IMAGE:5101184)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Bhmt (BC037004) Mouse Tagged ORF Clone
MG206399

USD 470.00

3 Weeks

Bhmt (GFP-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:46866 IMAGE:5100429)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Bhmt (BC093510) Mouse Tagged ORF Clone
MR206398L3

USD 440.00

3 Weeks

Lenti ORF clone of Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:103142 IMAGE:5101184)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (BC093510) Mouse Tagged ORF Clone Lentiviral Particle
MR206398L3V

USD 640.00

6 Weeks

Lenti ORF particles, Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:103142 IMAGE:5101184), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (BC093510) Mouse Tagged ORF Clone
MR206398L4

USD 440.00

3 Weeks

Lenti ORF clone of Bhmt (mGFP-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:103142 IMAGE:5101184)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (BC093510) Mouse Tagged ORF Clone Lentiviral Particle
MR206398L4V

USD 640.00

6 Weeks

Lenti ORF particles, Bhmt (GFP-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:103142 IMAGE:5101184), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (BC037004) Mouse Tagged ORF Clone
MR206399

USD 430.00

5 Days

Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:46866 IMAGE:5100429)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Bhmt (BC037004) Mouse Tagged ORF Clone
MR206399L3

USD 630.00

8 Weeks

Lenti ORF clone of Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:46866 IMAGE:5100429)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (BC037004) Mouse Tagged ORF Clone Lentiviral Particle
MR206399L3V

USD 830.00

11 Weeks

Lenti ORF particles, Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:46866 IMAGE:5100429), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (BC037004) Mouse Tagged ORF Clone
MR206399L4

USD 630.00

8 Weeks

Lenti ORF clone of Bhmt (mGFP-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:46866 IMAGE:5100429)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (BC037004) Mouse Tagged ORF Clone Lentiviral Particle
MR206399L4V

USD 830.00

11 Weeks

Lenti ORF particles, Bhmt (GFP-tagged) - Mouse betaine-homocysteine methyltransferase (cDNA clone MGC:46866 IMAGE:5100429), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (NM_016668) Mouse Tagged ORF Clone
MR206402L3

USD 630.00

3 Weeks

Lenti ORF clone of Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (Bhmt)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (NM_016668) Mouse Tagged ORF Clone Lentiviral Particle
MR206402L3V

USD 830.00

6 Weeks

Lenti ORF particles, Bhmt (Myc-DDK-tagged) - Mouse betaine-homocysteine methyltransferase (Bhmt), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (NM_016668) Mouse Tagged ORF Clone
MR206402L4

USD 630.00

3 Weeks

Lenti ORF clone of Bhmt (mGFP-tagged) - Mouse betaine-homocysteine methyltransferase (Bhmt)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (NM_016668) Mouse Tagged ORF Clone Lentiviral Particle
MR206402L4V

USD 830.00

6 Weeks

Lenti ORF particles, Bhmt (GFP-tagged) - Mouse betaine-homocysteine methyltransferase (Bhmt), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BHMT (NM_001713) Human Tagged ORF Clone
RC203148L3

USD 620.00

3 Weeks

Lenti ORF clone of Human betaine--homocysteine S-methyltransferase (BHMT), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BHMT (NM_001713) Human Tagged ORF Clone Lentiviral Particle
RC203148L3V

USD 820.00

6 Weeks

Lenti ORF particles, BHMT (Myc-DDK tagged) - Human betaine--homocysteine S-methyltransferase (BHMT), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
BHMT (NM_001713) Human Tagged ORF Clone
RC203148L4

USD 620.00

3 Weeks

Lenti ORF clone of Human betaine--homocysteine S-methyltransferase (BHMT), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BHMT (NM_001713) Human Tagged ORF Clone Lentiviral Particle
RC203148L4V

USD 820.00

6 Weeks

Lenti ORF particles, BHMT (mGFP-tagged) - Human betaine--homocysteine S-methyltransferase (BHMT), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (NM_030850) Rat Tagged ORF Clone
RR210729

USD 420.00

4 Weeks

Bhmt (Myc-DDK-tagged ORF) - Rat betaine-homocysteine methyltransferase (Bhmt), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Bhmt (NM_030850) Rat Tagged ORF Clone
RR210729L3

USD 640.00

9 Weeks

Lenti ORF clone of Bhmt (Myc-DDK-tagged ORF) - Rat betaine-homocysteine methyltransferase (Bhmt), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (NM_030850) Rat Tagged ORF Clone Lentiviral Particle
RR210729L3V

USD 850.00

13 Weeks

Lenti ORF particles, Bhmt (Myc-DDK-tagged ORF) - Rat betaine-homocysteine methyltransferase (Bhmt), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (NM_030850) Rat Tagged ORF Clone
RR210729L4

USD 700.00

9 Weeks

Lenti ORF clone of Bhmt (mGFP-tagged ORF) - Rat betaine-homocysteine methyltransferase (Bhmt), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Bhmt (NM_030850) Rat Tagged ORF Clone Lentiviral Particle
RR210729L4V

USD 960.00

13 Weeks

Lenti ORF particles, Bhmt (GFP-tagged ORF) - Rat betaine-homocysteine methyltransferase (Bhmt), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
BHMT Rabbit Polyclonal Antibody
TA346077

USD 410.00

5 Days

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
BHMT Rabbit Polyclonal Antibody
TA346078

USD 410.00

5 Days

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT
BHMT (391-402) Goat Polyclonal Antibody
AP22552PU-N

USD 440.00

2 Weeks

BHMT (391-402) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Hamster, Human, Monkey, Rat
Immunogen Synthetic peptide from C-term of human BHMT
Bhmt (NM_016668) Mouse Untagged Clone
MC203234

USD 210.00

In Stock

Bhmt (untagged) - Mouse betaine-homocysteine methyltransferase (Bhmt), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
BHMT Rabbit Polyclonal Antibody
TA327003

USD 275.00

3 Weeks

Rabbit anti-BHMT Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BHMT
BHMT (NM_001713) Human Over-expression Lysate
LY400644

USD 396.00

In Stock

Transient overexpression lysate of betaine-homocysteine methyltransferase (BHMT)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
BHMT (NM_001713) Human Over-expression Lysate
LC400644

USD 121.00

In Stock

BHMT HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
BHMT (NM_001713) Human Tagged ORF Clone
RC203148L1

USD 620.00

In Stock

Lenti ORF clone of Human betaine--homocysteine S-methyltransferase (BHMT), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
BHMT (NM_001713) Human Tagged ORF Clone
RC203148L2

USD 620.00

3 Weeks

Lenti ORF clone of Human betaine--homocysteine S-methyltransferase (BHMT), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
BHMT (NM_001713) Human Untagged Clone
SC110837

USD 760.00

In Stock

BHMT (untagged)-Human betaine--homocysteine S-methyltransferase (BHMT)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
BHMT Rabbit Polyclonal Antibody
TA308186

USD 415.00

5 Days

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088)
BHMT Rabbit Polyclonal Antibody
TA308187

USD 415.00

5 Days

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 243 of BHMT (Uniprot ID#Q93088)
BHMT Mouse Monoclonal Antibody [Clone ID: 3D6]
AM50001PU-N

USD 340.00

2 Weeks

BHMT mouse monoclonal antibody, clone 3D6, Purified

Applications ELISA, WB
Reactivities Human
BHMT Mouse Monoclonal Antibody [Clone ID: 3D6]
AM50001PU-S

USD 230.00

2 Weeks

BHMT mouse monoclonal antibody, clone 3D6, Purified

Applications ELISA, WB
Reactivities Human
BHMT Goat Polyclonal Antibody
TA302433

USD 375.00

5 Days

Goat Polyclonal Antibody against BHMT

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQQLKELFEKQK, from the C Terminus of the protein sequence according to NP_001704.1.
BHMT (His-tag) Human Protein
AR09005PU-L

USD 620.00

2 Weeks

BHMT (His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli