PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PKMYT1 (Myc-DDK tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PKMYT1 (mGFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PKMYT1 (GFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PKMYT1 (mGFP-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PKMYT1 (mGFP-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PKMYT1 (Myc-DDK tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PKMYT1 (mGFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PKMYT1 (Myc-DDK tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PKMYT1 (Myc-DDK tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PKMYT1 (GFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PKMYT1 (GFP-tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PKMYT1 (GFP-tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PKMYT1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PKMYT1 (untagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Transient overexpression of PKMYT1 (NM_182687) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression lysate of protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PKMYT1 (untagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
PKMYT1 (untagged)-Kinase deficient mutant (K139M) of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal MYT1 (Ab-83) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R). |
Rabbit polyclonal MYT1 (Ser83) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Myt1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS |
Carrier-free (BSA/glycerol-free) PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PKMYT1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PKMYT1 MS Standard C13 and N15-labeled recombinant protein (NP_004194)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
PKMYT1 (untagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
PKMYT1 (untagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-PKMYT1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PKMYT1 |
PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PKMYT1 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PKMYT1 mouse monoclonal antibody, clone OTI5E1 (formerly 5E1)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PKMYT1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PKMYT1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), Biotinylated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PKMYT1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), HRP conjugated
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PKMYT1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of PKMYT1 (NM_004203) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PKMYT1 (NM_001258450) in HEK293T cells paraffin embedded controls for ICC/IHC staining