EPAS1 (Myc-DDK-tagged)-Human endothelial PAS domain protein 1 (EPAS1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
EPAS1 (Myc-DDK-tagged)-Human endothelial PAS domain protein 1 (EPAS1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of endothelial PAS domain protein 1 (EPAS1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
EPAS1 (untagged)-Human endothelial PAS domain protein 1 (EPAS1)
Vector | pCMV6-XL6 |
Tag | Tag Free |
Mammalian Cell Selection | None |
USD 820.00
3 Weeks
Lenti ORF particles, EPAS1 (Myc-DDK tagged) - Human endothelial PAS domain protein 1 (EPAS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, EPAS1 (mGFP-tagged) - Human endothelial PAS domain protein 1 (EPAS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
EPAS1 (GFP-tagged) - Human endothelial PAS domain protein 1 (EPAS1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human endothelial PAS domain protein 1 (EPAS1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, EPAS1 (Myc-DDK tagged) - Human endothelial PAS domain protein 1 (EPAS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, EPAS1 (mGFP-tagged) - Human endothelial PAS domain protein 1 (EPAS1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal HIF-2 alpha Antibody
Applications | IHC, WB |
Reactivities | Fish, Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A peptide derived from the C-terminus of mouse/human HIF-2 alpha protein. |
Mouse Monoclonal Antibody against HIF-2 alpha (ep190b)
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
EPAS1 (untagged)-Human endothelial PAS domain protein 1 (EPAS1)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
EPAS1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human endothelial PAS domain protein 1 (EPAS1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
HIF 2 alpha (EPAS1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 127-154 amino acids from the N-terminal region of Human HIF2A |
Mouse monoclonal HIF2 alpha Antibody
Applications | IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-EPAS1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD |
Purified recombinant protein of Human endothelial PAS domain protein 1 (EPAS1), Leu584-end, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Mouse monoclonal Anti-HIF2A Clone Hif2a 237
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-HIF2A Clone EP190b
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
5 Days
EPAS1 mouse monoclonal antibody,clone 2G5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
5 Days
EPAS1 mouse monoclonal antibody,clone 2G5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EPAS1 mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
EPAS1 mouse monoclonal antibody,clone OTI6G3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
EPAS1 mouse monoclonal antibody,clone OTI6G3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
EPAS1 mouse monoclonal antibody,clone OTI6G3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of EPAS1 (NM_001430) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of EPAS1 (NM_001430) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of EPAS1 (NM_001430) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack