Germany
Japan
United Kingdom
China
CDK7 (Myc-DDK-tagged)-Human cyclin-dependent kinase 7 (CDK7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human cyclin-dependent kinase 7 (CDK7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CDK7 (untagged)-Human cyclin-dependent kinase 7 (CDK7)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, CDK7 (Myc-DDK tagged) - Human cyclin-dependent kinase 7 (CDK7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, CDK7 (mGFP-tagged) - Human cyclin-dependent kinase 7 (CDK7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Cdk7 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 7 (Cdk7)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cdk7 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (cDNA clone MGC:6069 IMAGE:3585145)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDK7 (GFP-tagged) - Human cyclin-dependent kinase 7 (CDK7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
CDK7 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402736 is the updated version of KN202736.
Cdk7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN503049 is the updated version of KN303049.
Cdk7 (GFP-tagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (cDNA clone MGC:6069 IMAGE:3585145)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cdk7 (GFP-tagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (Cdk7)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Cdk7 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (cDNA clone MGC:6069 IMAGE:3585145)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdk7 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (cDNA clone MGC:6069 IMAGE:3585145),, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdk7 (mGFP-tagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (cDNA clone MGC:6069 IMAGE:3585145)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdk7 (GFP-tagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (cDNA clone MGC:6069 IMAGE:3585145),, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdk7 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 7 (Cdk7)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdk7 (Myc-DDK-tagged) - Mouse cyclin-dependent kinase 7 (Cdk7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Cdk7 (mGFP-tagged) - Mouse cyclin-dependent kinase 7 (Cdk7)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Cdk7 (GFP-tagged) - Mouse cyclin-dependent kinase 7 (Cdk7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CDK7 (Myc-DDK tagged) - Human cyclin-dependent kinase 7 (CDK7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, CDK7 (mGFP-tagged) - Human cyclin-dependent kinase 7 (CDK7), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
CDK7 Mutant (Q123X), Myc-DDK-tagged ORF clone of Homo sapiens cyclin-dependent kinase 7 (CDK7) as transfection-ready DNA
| Mutation | Q123X |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human cyclin-dependent kinase 7 (CDK7), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human cyclin-dependent kinase 7 (CDK7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human cyclin-dependent kinase 7 (CDK7), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
CDK7 mouse monoclonal antibody, clone MO-1.1, Aff - Purified
| Applications | FC, IF, IHC, IP, WB |
CDK7 (untagged)-Kinase deficient mutant (K41M) of Human cyclin-dependent kinase 7 (CDK7)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Cdk7 (untagged) - Mouse cyclin-dependent kinase 7 (homolog of Xenopus MO15 cdk-activating kinase) (cDNA clone MGC:6069 IMAGE:3585145),, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
CDK7 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR319666 is the updated version of SR300737.
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 Antibody: A synthesized peptide derived from human CDK7 |
Goat Polyclonal Anti-CDK7 (aa47-58) Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 (aa47-58) Antibody: Peptide with sequence C-HRSEAKDGINRT, from the internal region of the protein sequence according to NP_001790.1. |
CDK7 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
CDK7 mouse monoclonal antibody, clone IMD-26, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Cdk7 (untagged) - Mouse cyclin-dependent kinase 7 (Cdk7), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human cyclin-dependent kinase 7 (CDK7), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal Phospho-CDK7(T170) Antibody
| Applications | Dot, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CDK7 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T170 of human CDK7. |
| Modifications | Phospho-specific |
qSTAR qPCR primer pairs against Homo sapiens gene CDK7
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
CDK7 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the C terminal of human CDK7. Synthetic peptide located within the following region: NRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF |
CDK7 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of cyclin-dependent kinase 7 (CDK7)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Cdk7
Rabbit Polyclonal anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 antibody is: synthetic peptide directed towards the N-terminal region of Human CDK7. Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the middle region of human CDK7. Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE |
CDK7 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
CDK7 CRISPRa kit - CRISPR gene activation of human cyclin dependent kinase 7
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Cdk7 CRISPRa kit - CRISPR gene activation of mouse cyclin-dependent kinase 7
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Active filters
Target Symbol
- CDK7