Germany
Japan
United Kingdom
China
DCK (Myc-DDK-tagged)-Human deoxycytidine kinase (DCK)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, DCK (Myc-DDK tagged) - Human deoxycytidine kinase (DCK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DCK (mGFP-tagged) - Human deoxycytidine kinase (DCK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DCK (GFP-tagged) - Human deoxycytidine kinase (DCK)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Dck (Myc-DDK-tagged) - Mouse deoxycytidine kinase (Dck)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DCK (Myc-DDK tagged) - Human deoxycytidine kinase (DCK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DCK - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410767 is the updated version of KN210767.
Dck - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504322 is the updated version of KN304322.
Dck (GFP-tagged) - Mouse deoxycytidine kinase (Dck)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dck (Myc-DDK-tagged) - Mouse deoxycytidine kinase (Dck)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dck (Myc-DDK-tagged) - Mouse deoxycytidine kinase (Dck), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dck (mGFP-tagged) - Mouse deoxycytidine kinase (Dck)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dck (GFP-tagged) - Mouse deoxycytidine kinase (Dck), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, DCK (mGFP-tagged) - Human deoxycytidine kinase (DCK), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Dck (Myc-DDK-tagged ORF) - Rat deoxycytidine kinase (Dck), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Dck (Myc-DDK-tagged ORF) - Rat deoxycytidine kinase (Dck), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dck (Myc-DDK-tagged ORF) - Rat deoxycytidine kinase (Dck), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Dck (mGFP-tagged ORF) - Rat deoxycytidine kinase (Dck), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Dck (GFP-tagged ORF) - Rat deoxycytidine kinase (Dck), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DCK (untagged)-Human deoxycytidine kinase (DCK)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human deoxycytidine kinase (DCK), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human deoxycytidine kinase (DCK), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human deoxycytidine kinase (DCK), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Transient overexpression lysate of deoxycytidine kinase (DCK)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
DCK HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Recombinant protein of human deoxycytidine kinase (DCK), full length with N-terminal polyhistidine tag, expressed in sf9 cells.
| Tag | N-His |
| Expression Host | Sf9 |
DCK (untagged)-Human deoxycytidine kinase (DCK)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human deoxycytidine kinase (DCK), full length, with C-terminal DDK tag,expressed in sf9 cells
| Tag | C-DDK |
| Expression Host | Sf9 |
Lenti ORF clone of Human deoxycytidine kinase (DCK), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DCK (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR319895 is the updated version of SR301153.
Rabbit Polyclonal DCK Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Dck (untagged) - Mouse deoxycytidine kinase (Dck), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Homo sapiens gene DCK
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
3`UTR clone of deoxycytidine kinase (DCK) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Rabbit Polyclonal Anti-DCK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCK antibody: synthetic peptide directed towards the middle region of human DCK. Synthetic peptide located within the following region: QLASLNGKLKDAEKPVLFFERSVYSDRYIFASNLYESECMNETEWTIYQD |
Rabbit Polyclonal Anti-DCK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DCK antibody: synthetic peptide directed towards the middle region of human DCK. Synthetic peptide located within the following region: ATPETCLHRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDYLQ |
Deoxycytidine kinase (1-260, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Deoxycytidine kinase (1-260, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
DCK CRISPRa kit - CRISPR gene activation of human deoxycytidine kinase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Dck CRISPRa kit - CRISPR gene activation of mouse deoxycytidine kinase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene DCK
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Mus musculus gene Dck
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Dck
DCK MS Standard C13 and N15-labeled recombinant protein (NP_000779)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Active filters
Target Symbol
- DCK