Primary Antibodies

View as table Download

SPTLC1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide derived from the Human Sserine Palmitoyltransferase enzyme

DEGS1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the Human DEGS1 protein

Rabbit polyclonal anti-GLB1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GLB1.

Rabbit polyclonal Neuraminidase antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-124 of Human Neu2.

Rabbit Polyclonal SPT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen SPT1 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human SPT1. The immunogen is located within amino acids 380 - 430 of SPT1.

Rabbit Polyclonal anti-PPAP2A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV

Rabbit polyclonal Anti-SMPD3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMPD3 antibody: synthetic peptide directed towards the middle region of human SMPD3. Synthetic peptide located within the following region: RPPEADDPVPGGQARNGAGGGPRGQTPNHNQQDGDSGSLGSPSASRESLV

Rabbit Polyclonal Anti-GALC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GALC Antibody: synthetic peptide directed towards the middle region of human GALC. Synthetic peptide located within the following region: LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Rabbit Polyclonal Anti-SGPP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGPP2 antibody: synthetic peptide directed towards the C terminal of human SGPP2. Synthetic peptide located within the following region: SKPAESLPVIQNIPPLTTYMLVLGLTKFAVGIVLILLVRQLVQNLSLQVL

Rabbit Polyclonal Anti-CERK Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CERK antibody is: synthetic peptide directed towards the C-terminal region of Human CERK. Synthetic peptide located within the following region: FVEVYRVKKFQFTSKHMEDEDSDLKEGGKKRFGHICSSHPSCCCTVSNSS

Rabbit Polyclonal Anti-DEGS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DEGS1 antibody: synthetic peptide directed towards the N terminal of human DEGS1. Synthetic peptide located within the following region: GSRVSREDFEWVYTDQPHADRRREILAKYPEIKSLMKPDPNLIWIIIMMV

Rabbit Polyclonal Anti-ACER2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACER2 antibody is: synthetic peptide directed towards the middle region of Human ACER2. Synthetic peptide located within the following region: DELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLAFV

Rabbit Polyclonal Anti-SGMS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY

Rabbit Polyclonal Anti-SPTLC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI

sphingosine 1 phosphate phosphatase 1 (SGPP1) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from the sphingosine 1-phosphate phosphatase 1 protein.

Sphingosine 1 phosphate phosphatase 2 (SGPP2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from the sphingosine 1-phosphate phosphatase 2 protein.

SPTLC1 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from the human serine palmitoyltransferase enzyme

DEGS2 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from human DEGS2 protein

DEGS2 rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from Human DEGS2 protein

NSMase2 (SMPD3) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from human sphingomyelin phosphodiesterase 3

NSMase2 (SMPD3) rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide derived from human sphingomyelin phosphodiesterase 3

DEGS1 rabbit polyclonal antibody, Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the Human DEGS1 protein.

GBA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide directed towards the C-term region of human Glucosylceramidase

Sphingomyelin Synthase 2 (SGMS2) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of Human SGMS2.

Rabbit Polyclonal Antibody against Ceramide Kinase

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human ceramide kinase protein sequence (between residues 50-150). [Swiss-Prot Q8TCT0]

Rabbit Polyclonal ASAH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ASAH2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of the human ASAH2.

Rabbit Polyclonal Sphingosine Kinase 1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to a region between residue 334-384 of human sphingosine kinase 1 using the numbering given in entry NP_001136073.1

Rabbit polyclonal SPHK2(Thr614) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human SPHK2 around the phosphorylation site of threonine 614 (P-L-TP-P-R).
Modifications Phospho-specific

Rabbit polyclonal anti-ACER1 (ASAH3) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ASAH3.

Rabbit polyclonal anti-Sphingosine Kinase 1 (SPK1) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acid 180 of mouse Sphingosine Kinase 1

Rabbit polyclonal SH3BP2 phospho S427 antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 422-433 of Human SH3BP3 protein (SH3 Domain Binding Protein 2).
Modifications Phospho-specific

Rabbit polyclonal Anti-SGMS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Rabbit Polyclonal Anti-NEU2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-NEU2 antibody is: synthetic peptide directed towards the N-terminal region of Human NEU2. Synthetic peptide located within the following region: ANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLH

Rabbit Polyclonal Anti-ENPP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the middle region of Human ENPP7. Synthetic peptide located within the following region: DLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLT

Rabbit Polyclonal Anti-ENPP7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ENPP7 Antibody is: synthetic peptide directed towards the N-terminal region of Human ENPP7. Synthetic peptide located within the following region: WITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANI

Rabbit Polyclonal Anti-SGPL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGPL1 antibody is: synthetic peptide directed towards the C-terminal region of Human SGPL1. Synthetic peptide located within the following region: IHFCITLLHARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTT

Rabbit Polyclonal Anti-SGMS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGMS2 antibody: synthetic peptide directed towards the N terminal of human SGMS2. Synthetic peptide located within the following region: KFPLEWWKTGIAFIYAVFNLVLTTVMITVVHERVPPKELSPPLPDKFFDY

Rabbit Polyclonal Anti-SPTLC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPTLC1 antibody: synthetic peptide directed towards the middle region of human SPTLC1. Synthetic peptide located within the following region: DLERLLKEQEIEDQKNPRKARVTRRFIVVEGLYMNTGTICPLPELVKLKY

Rabbit Polyclonal Anti-SMPD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMPD1 antibody: synthetic peptide directed towards the middle region of human SMPD1. Synthetic peptide located within the following region: INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV

Rabbit Polyclonal Anti-SGPP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SGPP1 antibody: synthetic peptide directed towards the middle region of human SGPP1. Synthetic peptide located within the following region: THKYAPFIIIGLHLALGIFSFTLDTWSTSRGDTAEILGSGAGIACGSHVT

Rabbit Polyclonal Anti-NEU4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU4 antibody: synthetic peptide directed towards the N terminal of human NEU4. Synthetic peptide located within the following region: TGTVFLFFIAVLGHTPEAVQIATGRNAARLCCVASRDAGLSWGSARDLTE

Rabbit Polyclonal Anti-SPHK1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SPHK / SPHK1 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human SPHK1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Dog, Bat, Elephant, Panda, Rabbit (93%); Horse (87%); Mouse, Rat, Bovine (80%).

Rabbit Polyclonal Anti-SPHK1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen SPHK / SPHK1 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human SPHK1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (93%); Bat, Pig (87%); Mouse, Rat, Hamster (80%).

Rabbit Polyclonal Anti-CERK Antibody (Internal)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Ceramide Kinase / CERK antibody was raised against synthetic 14 amino acid peptide from internal region of human CERK. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Panda (100%); Gorilla, Dog, Elephant, Horse (93%); Mouse, Rat, Hamster (86%).

Rabbit Polyclonal Anti-CERK Antibody (N-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Ceramide Kinase / CERK antibody was raised against synthetic 20 amino acid peptide from N-terminal extracellular domain of human CERK. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset (90%); Dog, Panda (85%); Bovine, Elephant, Rabbit (80%).

Rabbit Polyclonal Anti-SPHK1 Antibody (N-Terminus)

Applications IHC
Reactivities Human
Immunogen SPHK / SPHK1 antibody was raised against synthetic 15 amino acid peptide from N-Terminus of human SPHK1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Elephant, Panda, Dog, Bat, Rabbit (93%); Horse (87%); Bovine (80%).

Rabbit Polyclonal Anti-Smpd4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Smpd4 antibody is: synthetic peptide directed towards the middle region of Rat Smpd4. Synthetic peptide located within the following region: LHSPAQPSLQALHAYQESFMPTEEHVLVVRLLLKHLHAFANSLKPDQASP

Rabbit Polyclonal Anti-ACER1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACER1 antibody: synthetic peptide directed towards the C terminal of human ACER1. Synthetic peptide located within the following region: ITFPYGMVTMALVDANYEMPGETLKVRYWPRDSWPVGLPYVEIRGDDKDC

Rabbit anti SPHK1 Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti SPHK2 Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A recombinant protein encoding the full length of 618 aa human SPHK2.