c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, HRP
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, AP
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | AP |
Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1
Applications | ELISA, FC, IF, IHC, IP, WB |
Reactivities | Human, Rat |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
Applications | ELISA, FC, IHC, IP, WB |
Reactivities | Human |
Purified BIRC5/Survivin Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI2D9
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700032 |
purified MYC Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI3F2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700496 |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
HDAC1 mouse monoclonal antibody, clone 5C11, Purified
Applications | ELISA, IF, IHC, PLA, WB |
Reactivities | Human, Mouse, Rat |
c-Myc (MYC) mouse monoclonal antibody, clone 9E10, Purified
Applications | ELISA, FC, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal HDAC2 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
purified MYC Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700497 |
BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Mouse |
BCL2 (1-211) mouse monoclonal antibody, clone AT1B5, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human, Mouse |
c Kit (KIT) (41-140) mouse monoclonal antibody, clone 5F6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
HDAC1 mouse monoclonal antibody, clone 3E1, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
HDAC1 mouse monoclonal antibody, clone 1D6, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
HDAC1 mouse monoclonal antibody, clone 5A11, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Caspase 9 (CASP9) (299-318) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Immunogen | Akirin1 antibody was raised against peptide corresponding to aa 299-318 of the human Caspase 9. |
c-Myc (MYC) chicken polyclonal antibody, FITC
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | FITC |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. After repeated injections, immune eggs were collected, from which the IgY fractions were prepared. |
c-Myc (MYC) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Immunogen | This antibody was purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. |
Rabbit Polyclonal HDAC1 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-HDAC1 antibody: the C-terminal region of human HDAC1 (Histone deacetylase 1), using a KLH-conjugated synthetic peptide. |
c Kit (KIT) (41-140) mouse monoclonal antibody, clone 6G12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone 4F7, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone X1, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
Applications | ELISA, IHC, WB |
Conjugation | Biotin |
Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) rabbit polyclonal antibody, HRP
Applications | ELISA, IHC, WB |
Conjugation | HRP |
Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
Rabbit Polyclonal Bcl2 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
PIAS2 (431-445) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC |
Reactivities | Bat, Canine, Equine, Human, Rabbit |
Immunogen | Synthetic peptide from an internal region of human PIAS2 |
PIAS2 (185-196) goat polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Bovine, Canine, Human, Mouse, Rat |
Immunogen | Peptide with sequence PQQVREICISRD, from the internal region of the protein sequence according to NP_775298.1; NP_004662.2. |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Purified BIRC5/Survivin Capture mouse monoclonal antibody, ELISA validated, clone OTI3G3
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700033 |
Anti-TP53 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
Anti-CASP9 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-CTBP2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human C-terminal binding protein 2 |
Anti-BIRC5 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
USD 399.00
In Stock
biotinylated detection antibody BIRC5/Survivin biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI3G3
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600032 |
USD 399.00
2 Weeks
BIRC5/Survivin biotinylated detection antibody, ELISA validated mouse monoclonal antibody, clone OTI2D9
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
Matched ELISA Pair | TA600033 |
USD 399.00
In Stock
MYC biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI1A6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600496 |
USD 399.00
In Stock
MYC biotinylated detection antibody, ELISA and Luminex validated mouse monoclonal antibody, clone OTI3F2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
Matched ELISA Pair | TA600497 |