Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
HSP70-1A (HSPA1A) mouse monoclonal antibody, clone SJ-70, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Calreticulin (CALR) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Rat |
| Immunogen | This CALR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 277-305 amino acids from the Central region of Human CALR. |
NKG2C (KLRC2) (N-term) rabbit polyclonal antibody
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human KLRC2. |
beta 2 Microglobulin (B2M) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Human b2-Microglobulin. |
B2M / Beta 2 Microglobulin Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Calnexin Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Avian, Drosophila |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the canine Calnexin protein (within residues 25-100). [Swiss-Prot P24643] |
USD 340.00
2 Weeks
USD 230.00
2 Weeks
Cathepsin L (CTSL) mouse monoclonal antibody, clone CP-L14, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
CD4 mouse monoclonal antibody, clone B-A1, Purified
| Applications | FC, IHC |
| Reactivities | Human |
HSP90AA1 rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rabbit, Rat |
| Immunogen | Recombinant human Hsp90 R protein |
CIITA (N-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human, Monkey |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3 |
Rabbit polyclonal HSP90B (Ser254) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal HSP90AB1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 697-724 amino acids from the C-terminal region of human HSP90AB1. |
Rabbit polyclonal HSP90AB1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HSP90AB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 438-465 amino acids from the Central region of human HSP90AB1. |
Rabbit polyclonal HLA-B Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Rabbit Polyclonal Anti-TAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Active filters
Category
- Antibodies
Applications
- IHC
Pathways
- Antigen processing and presentation
Filter by
Target Symbol
- CD4 (85)
- CTSL (52)
- HSPA1A (38)
- CD8A (35)
- RFXANK (35)
- CD74 (23)
- B2M (18)
- PDIA3 (17)
- CREB1 (15)
- HSP90AA1 (11)
- HSP90AB1 (11)
- HSPA8 (10)
- SMURF2 (8)
- CALR (7)
- CANX (6)
- HLA-DRB5 (6)
- HSPA5 (5)
- CTSB (4)
- TAP2 (4)
- LTA (3)
- NFYA (3)
- NFYC (3)
- TAPBP (3)
- CIITA (2)
- HLA-DMB (2)
- HLA-DPB1 (2)
- HLA-G (2)
- IFNA2 (2)
- KIR2DL3 (2)
- KLRC1 (2)
- PSME2 (2)
- PSME3 (2)
- CTSS (1)
- HLA-A (1)
- HLA-B (1)
- HLA-DMA (1)
- HLA-DOA (1)
- HLA-F (1)
- HSPA4 (1)
- HSPA6 (1)
- IFI30 (1)
- IFNA16 (1)
- IFNA8 (1)
- KIR2DL4 (1)
- KIR3DL1 (1)
- KIR3DL3 (1)
- KLRC2 (1)
- LGMN (1)
- NFYB (1)
- TAP1 (1)
Reactivities
- Human (376)
- Mouse (156)
- Rat (145)
- Monkey (35)
- Dog (22)
- Bovine (8)
- Chicken (8)
- Rabbit (7)
- Drosophila (4)
- Hamster (4)
- Sheep (4)
- Guinea Pig (3)
- Pig (3)
- Chimpanzee (2)
- Primate (2)
- Rhesus Monkey (2)
- Xenopus (2)
- Avian (1)
- Beluga (1)
- C. elegans (1)
- Canine (1)
- Carp (1)
- Fish (1)
- Fungi (1)
- Insect (1)
- Plant (1)
- Porcine (1)
- Quail (1)
- Yeast (1)