Primary Antibodies

View as table Download

Rabbit Monoclonal antibody against Gli-1 (GLI1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

BMP6 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 125-170 of Human BMP-6.

PTCH1 (C-term) goat polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC
Reactivities Human, Mouse, Rat
Immunogen Peptide with sequence from the C Terminus of Human PTCH1 (NP_001077073.1, NP_001077074.1, NP_001077075.1, NP_001077076.1)

Rabbit Polyclonal Gli1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]

BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2.

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA

Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human

Rabbit anti-PRKACB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKACB

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT

BMP4 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rabbit, Rat
Immunogen Synthetic peptide surrounding amino acid 395 of Human BMP-4

Rabbit Polyclonal Anti-WNT9B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the C terminal of human WNT9B. Synthetic peptide located within the following region: FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD

Rabbit Polyclonal Anti-WNT2B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT

Rabbit Polyclonal Anti-SUFU Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SUFU antibody: synthetic peptide directed towards the middle region of human SUFU. Synthetic peptide located within the following region: LQILLTEEFVEKMLEDLEDLTSPEEFKLPKEYSWPEKKLKVSILPDVVFD

Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014)

Rabbit polyclonal WNT5B Antibody (Center)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B.

WNT3A mouse monoclonal antibody, clone 3A6, Purified

Applications ELISA, IHC, WB
Reactivities Human

GAS1 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 102-136 amino acids from the N-terminal region of human GAS1

Rabbit Polyclonal Wnt10b Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10b antibody was raised against a 15 amino acid peptide from near the center of human Wnt10b.

Rabbit polyclonal anti-Gli-3 antibody

Applications IF, IHC, WB
Reactivities Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein.

Rabbit Polyclonal Anti-WNT5A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT

Rabbit Polyclonal BMP-2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643]

Mouse Monoclonal GSK-3 beta Antibody (3D10)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated

Rabbit Polyclonal Wnt10a Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Wnt10a antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human Wnt10a.

Rabbit Polyclonal antibody to HHIP (hedgehog interacting protein)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 554 of HHIP (Uniprot ID#Q96QV1)

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.

Rabbit polyclonal anti-CKI-a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a.

Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C).
Modifications Phospho-specific

TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε.

BMP7 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide cooresponding aa 140-190 of human BMP7

WNT3 (315-329) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Chicken, Equine, Human, Monkey, Mouse, Porcine, Rat, Xenopus, Zebrafish
Immunogen Synthetic peptide from an internal region of human WNT3

Smoothened (SMO) (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen SMO antibody was raised against synthetic peptide - KLH conjugated

Rabbit polyclonal CK-1a (Tyr294) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CK-1a around the phosphorylation site of tyrosine 294 (Y-D-YP-T-F).
Modifications Phospho-specific

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.

Rabbit polyclonal anti-STK36 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human STK36.

Rabbit polyclonal anti-CKI-a1/L antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-a1/L.

WNT2B Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT2B antibody was raised against synthetic 16 amino acid peptide from internal region of human WNT2B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Panda, Horse, Rabbit, Pig (100%); Elephant (94%); Opossum, Platypus (88%).

GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta.

Mouse Anti-Human SMO / Smoothened Monoclonal Antibody

Applications IHC
Reactivities Human

Anti-SUFU Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human suppressor of fused homolog (Drosophila)

Anti-Human BMP-7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CHO cells derived Recombinant Human BMP-7

Rabbit Polyclonal anti-GLI2 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE

Mouse Monoclonal Sonic Hedgehog/Shh Antibody (5H4)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Rabbit Polyclonal Sonic Hedgehog/Shh Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the human SHH protein (between residues 1-75) [UniProt Q15465]

Rabbit Polyclonal Anti-WNT10B Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT10B antibody: synthetic peptide directed towards the middle region of human WNT10B. Synthetic peptide located within the following region: GTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR

Rabbit Polyclonal Anti-WNT7B Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM

Casein Kinase 1 alpha (CSNK1A1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

CSNK1G2 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

CSNK1G1 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated