Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal CYP27B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP27B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 482-508 amino acids from the C-terminal region of human CYP27B1. |
Rabbit Polyclonal Anti-CYP4F3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF |
Rabbit Polyclonal Anti-CYP4A22 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ |
Rabbit polyclonal CYP1A2 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CYP1A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-282 amino acids from the Central region of human CYP1A2. |
Rabbit polyclonal CYP2B6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2B6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 235-263 amino acids from the Central region of human CYP2B6. |
USD 370.00
2 Weeks
Cytochrome P450 3A4 (CYP3A4) (+ CYP3A5) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 351-400 of Human CYP3A4. |
Rabbit polyclonal antibody to Cytochrome P450 4A11 (cytochrome P450, family 4, subfamily A, polypeptide 11)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 48 and 316 of CYP4A11 (Uniprot ID#Q02928) |
Rabbit polyclonal Cytochrome P450 2C8 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 2C8. |
| Modifications | Phospho-specific |
Rabbit polyclonal Cytochrome P450 1A2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 1A2. |
Rabbit polyclonal Cytochrome P450 4F2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human Cytochrome P450 4F2. |
Rabbit polyclonal CYP3A5 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP3A5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 476-502 amino acids from the C-terminal region of human CYP3A5. |
Rabbit polyclonal CYP2E1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP2E1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 402-429 amino acids from the C-terminal region of human CYP2E1. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit Polyclonal Anti-CYP11B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP11B1 antibody: synthetic peptide directed towards the C terminal of human CYP11B1. Synthetic peptide located within the following region: ARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGL |
Cytochrome P450 2E1 (CYP2E1) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide mapping at the C-terminal of human P450ⅡE1 |
Rabbit Polyclonal Anti-CYP11A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1. Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW |
Rabbit Polyclonal Anti-CYP21A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP21A2 antibody: synthetic peptide directed towards the C terminal of human CYP21A2. Synthetic peptide located within the following region: IQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEVLRLRPVVPLA |
Anti-ARO Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 240-255 amino acids of Human Aromatase |
Anti-CYP3A4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP2E1 |
Rabbit Polyclonal Anti-CYP17A1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP17A1 |
Rabbit Polyclonal Anti-TBXAS1 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human TBXAS1 |
Rabbit Polyclonal Anti-CYP4A11 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP4A11 |
Rabbit Polyclonal Anti-CYP7A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CYP7A1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Applications
- IHC
Clonalities
- Polyclonal
Families
- P450
Pathways
- Metabolic pathways