Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MCM5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MCM5

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MCM6

Rabbit Polyclonal Anti-MCM7 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human MCM7

Rabbit anti-RPA2 Polyclonal Antibody

Applications ChIP, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPA2

Rabbit Polyclonal Anti-MCM2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human MCM2

LIG1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human LIG1

Rabbit Polyclonal Anti-RNASEH2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASEH2A antibody: synthetic peptide directed towards the middle region of human RNASEH2A. Synthetic peptide located within the following region: AQTILEKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLE

Rabbit Polyclonal Anti-RNASEH2A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASEH2A antibody: synthetic peptide directed towards the C terminal of human RNASEH2A. Synthetic peptide located within the following region: EKEAEDVIWEDSASENQEGLRKITSYFLNEGSQARPRSSHRYFLERGLES

Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993)

Rabbit polyclonal anti-MtSSB antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MtSSB.

Rabbit anti-POLD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLD1

Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694)

Rabbit Polyclonal PCNA Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit polyclonal anti-MCM5 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MCM5 antibody.

Rabbit Polyclonal MCM6 Antibody

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Dog
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit Polyclonal RFC4 Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

Rabbit polyclonal anti-PCNA antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human PCNA.

Rabbit polyclonal anti-FEN1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FEN1.

Rabbit polyclonal anti-MCM2 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MCM2.

Rabbit polyclonal PCNA Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PCNA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 89-117 amino acids from the Central region of human PCNA.

Rabbit Polyclonal antibody to RFC4 (replication factor C (activator 1) 4, 37kDa)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 18 and 323 of RFC4 (Uniprot ID#P35249)

Rabbit Polyclonal antibody to MCM3 (minichromosome maintenance complex component 3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 42 and 302 of MCM3 (Uniprot ID#P25205)

Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244)

Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927)

Rabbit polyclonal anti-MMP-11 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-11 antibody.

Rabbit polyclonal anti-POLE antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLE1.

Rabbit polyclonal anti-POLE4 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human POLE4.

Rabbit anti-FEN1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FEN1

Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S).
Modifications Phospho-specific

Rabbit Polyclonal MCM2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human MCM2.

Rabbit Polyclonal Anti-RFC5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFC5 antibody: synthetic peptide directed towards the N terminal of human RFC5. Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE

Rabbit Polyclonal Anti-MCM3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM3 antibody: synthetic peptide directed towards the C terminal of human MCM3. Synthetic peptide located within the following region: SQEDQEQKRKRRKTRQPDAKDGDSYDPYDFSDTEEEMPQVHTPKTADSQE

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

Rabbit Polyclonal Anti-MCM6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6. Synthetic peptide located within the following region: RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPYLVVNPNYLLE

Rabbit Polyclonal Anti-MCM7 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM7 antibody: synthetic peptide directed towards the middle region of human MCM7. Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV

Anti-PCNA Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 9-252 amino acids of Human Proliferating cell nuclear antigen

Anti-MCM4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 837-850 amino acids of Human minichromosome maintenance complex component 4

Anti-MCM3 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human minichromosome maintenance complex component 3

Anti-MCM3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human minichromosome maintenance complex component 3

Anti-MCM7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a C terminal 300 amino acids of human minichromosome maintenance complex component 7

Rabbit Polyclonal Anti-LIG1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LIG1

Rabbit Polyclonal Anti-RPA2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit Polyclonal Anti-SSBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SSBP1