Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal PEK/PERK (Thr981) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PEK/PERK around the phosphorylation site of threonine 981 (R-H-TP-G-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit polyclonal Amyloid β A4 (Phospho-Thr743/668) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Amyloid β A4 around the phosphorylation site of threonine 743 (A-V-TP-P-E) |
| Modifications | Phospho-specific |
APP Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | N term -peptide of human APP |
Rabbit anti-MME Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MME |
NMDAR1 (GRIN1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human NMDAR1 |
GAPDH rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mammalian, Mouse, Rat |
| Immunogen | Purified recombinant human GAPDH |
Tau (MAPT) chicken polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Antipeptide antibodies were generated in chickens against two sequences shared between the Mouse (P10637.3) and Human (P10636.5) gene products. Neither of these sequences contain phosphorylated serine or threonine residues, so these tau antibodies recognize both the euphosphorylated and hyperphosphorylated forms of Tau. Production: After repeated injections, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity-purified using a peptide column, and the concentrations of the eluates adjusted to 0.2 mg/ml. Finally, equal volumes of both of these affinity-purified anti-peptide antibodies were mixed, and the preparation was filter-sterilized. |
APPBP1 rabbit polyclonal  antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NAE1 (APPBP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 430-459 amino acids from the C-terminal region of human NAE1 (APPBP1). |
Rabbit polyclonal FADD (Ser191) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FADD around the phosphorylation site of serine 191 (N-M-SP-P-V). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
| Modifications | Phospho-specific |
COX7A2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50). |
GSK3B / GSK3 Beta Rabbit Polyclonal (pSer9) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GSK3B / GSK3 Beta antibody was raised against synthetic peptide from human GSK3B / GSK3 Beta. |
NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913). |
Rabbit polyclonal GAPDH Antibody (C-term R248)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This GAPDH antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 233-259 amino acids from the C-terminal region of human GAPDH. |
Active filters
Applications
- IHC
Pathways
- Alzheimer's disease
Filter by
Category
Target Symbol
- APP (68)
- ATP5F1B (41)
- APOE (39)
- BID (36)
- LPL (35)
- MME (30)
- MAPK1 (29)
- NDUFB10 (26)
- GAPDH (25)
- MAPT (24)
- CASP3 (22)
- HSD17B10 (20)
- SDHB (20)
- TNF (19)
- NDUFB9 (18)
- BAD (17)
- CHP1 (17)
- CASP7 (14)
- CASP9 (14)
- NDUFS2 (13)
- APAF1 (11)
- COX6C (10)
- GRIN1 (10)
- NDUFA4L2 (10)
- PPP3CA (10)
- GSK3B (9)
- COX4I1 (8)
- MAPK3 (8)
- NAE1 (8)
- ATP5F1C (7)
- SNCA (7)
- ATF6 (6)
- CASP8 (6)
- CDK5 (6)
- IL1B (6)
- NDUFA2 (6)
- NDUFA7 (6)
- NOS2 (6)
- TNFRSF1A (6)
- UQCRC1 (6)
- UQCRFS1 (6)
- ATP5PO (5)
- CAPN2 (5)
- NOS3 (5)
- ATP5PF (4)
- BACE1 (4)
- BACE2 (4)
- CACNA1C (4)
- COX6B1 (4)
- CYCS (4)
- EIF2AK3 (4)
- FADD (4)
- GRIN2A (4)
- NDUFA10 (4)
- PLCB3 (4)
- ATP2A1 (3)
- FAS (3)
- GRIN2B (3)
- NCSTN (3)
- NDUFA8 (3)
- NDUFS1 (3)
- NDUFS4 (3)
- NDUFS8 (3)
- PSEN1 (3)
- SDHA (3)
- ADAM10 (2)
- ADAM17 (2)
- APH1A (2)
- ATP2A3 (2)
- ATP5F1A (2)
- ATP5F1D (2)
- CAPN1 (2)
- COX5A (2)
- COX5B (2)
- COX7B (2)
- COX7B2 (2)
- GRIN2C (2)
- GRIN2D (2)
- IDE (2)
- ITPR2 (2)
- NDUFA5 (2)
- NDUFA9 (2)
- NDUFAB1 (2)
- NDUFC2 (2)
- NDUFS5 (2)
- NDUFS6 (2)
- NDUFV2 (2)
- NOS1 (2)
- PPP3CC (2)
- PSENEN (2)
- SDHD (2)
- ATP2A2 (1)
- ATP5E (1)
- ATP5MC2 (1)
- ATP5MC3 (1)
- ATP5PD (1)
- CACNA1D (1)
- CACNA1S (1)
- CALM1 (1)
- CALM2 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (628)
- Transmembrane (232)
- Protease (118)
- Secreted Protein (77)
- ES Cell Differentiation/IPS (60)
- Protein Kinase (57)
- Stem cell - Pluripotency (53)
- Adult stem cells (39)
- Transcription Factors (32)
- Ion Channels: Glutamate Receptors (21)
- Phosphatase (14)
- Ion Channels: Calcium (6)
- Ion Channels: Sodium (4)