Primary Antibodies

Jump to Filters
View as table Download
Clathrin heavy chain (CLTC) Goat Polyclonal Antibody
TA316635

USD 425.00

In Stock

CLTC / Clathrin Heavy Chain Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chicken, Human, Monkey, Mouse, Rabbit, Rat, Xenopus, Zebrafish, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen CLTC / Clathrin Heavy Chain antibody was raised against synthetic peptide C-ESLRKEEEQATETQ from an internal region (near C-terminus) of human CLTC (NP_004850.1). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Platypus, Xenopus, Zebrafish (100%); Stickleback (93%); Pufferfish (86%).
COX7A2 Rabbit Polyclonal Antibody
TA316638

USD 425.00

5 Days

COX7A2 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen COX7A2 antibody was raised against synthetic peptide from human COX7S/A2 (aa1-50).
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
TA318695

USD 425.00

In Stock

NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913).
COX6B2 Rabbit Polyclonal Antibody
TA322050

USD 345.00

In Stock

Anti-COX6B2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 1-89 amino acids of human cytochrome c oxidase subunit VIb polypeptide 2 (testis)
ATP5PF Rabbit Polyclonal Antibody
TA323495

USD 345.00

In Stock

Anti-ATP5J rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein
ATP5PF Rabbit Polyclonal Antibody
TA323496

USD 345.00

In Stock

Anti-ATP5J rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein
CREB1 Rabbit Polyclonal Antibody
TA325386

USD 345.00

4 Weeks

Rabbit Polyclonal CREB Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human CREB.
p53 (TP53) Rabbit Polyclonal Antibody
TA326166

USD 345.00

4 Weeks

Rabbit polyclonal p53 (Phospho-Ser15) antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E).
Modifications Phospho-specific
NMDAR1 (GRIN1) Rabbit Polyclonal Antibody
TA326171

USD 345.00

In Stock

Rabbit polyclonal NMDAR1 (Phospho-Ser890) antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR1 around the phosphorylation site of serine 890 (A-S-SP-F-K).
Modifications Phospho-specific
APAF1 Rabbit Polyclonal Antibody
TA305972

USD 430.00

5 Days

Rabbit Polyclonal Apaf1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Apaf1 antibody was raised against a peptide corresponding to amino acids near the amino terminus of human Apaf1. The sequences of the immunogenic peptide are identical between human and mouse.
AP2M1 Chicken Polyclonal Antibody
TA306777

USD 430.00

5 Days

Chicken Polyclonal AP2M1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AP2M1 antibody was raised against a 16 amino acid peptide near the carboxy terminus of human AP2M1.
NDUFB9 Rabbit Polyclonal Antibody
TA306948

USD 430.00

5 Days

Rabbit Polyclonal LYRM3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen LYRM3 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human LYRM3.
COX6A2 Rabbit Polyclonal Antibody
TA307955

USD 415.00

5 Days

Rabbit Polyclonal antibody to COX6A2 (cytochrome c oxidase subunit VIa polypeptide 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 34 and 97 of COX6A2 (Uniprot ID#Q02221)
RPB2 (POLR2B) Rabbit Polyclonal Antibody
TA308532

USD 415.00

5 Days

Rabbit Polyclonal antibody to POLR2B (polymerase (RNA) II (DNA directed) polypeptide B, 140kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 172 of RNA polymerase IIB (Uniprot ID#P30876)
BAX Rabbit Polyclonal Antibody
TA312595

USD 345.00

4 Weeks

Rabbit polyclonal anti-BAX antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAX.
CREB1 Rabbit Polyclonal Antibody
TA313687

USD 345.00

4 Weeks

Rabbit polyclonal CREB (Ser133) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CREB around the phosphorylation site of serine 133 (R-P-SP-Y-R).
Modifications Phospho-specific
APAF1 Mouse Monoclonal Antibody [Clone ID: 2E10]
TA319611

USD 430.00

5 Days

Mouse Apaf-1 Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
LCMT2 Rabbit Polyclonal Antibody
TA319792

USD 430.00

5 Days

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.
Caspase 3 (CASP3) Rabbit Polyclonal Antibody
TA321922

USD 345.00

In Stock

Anti-CASP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 485-499 of Human caspase 3, apoptosis-related cysteine peptidase
HDAC2 Rabbit Polyclonal Antibody
TA323155

USD 345.00

4 Weeks

Anti-HDAC2 (Phospho-Ser394) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 394 (E-D-S(p)-G-D) derived from Human HDAC2.
Modifications Phospho-specific
HDAC2 Rabbit Polyclonal Antibody
TA323156

USD 345.00

4 Weeks

Anti-HDAC2 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa. 392~396 (E-D-S-G-D) derived from Human HDAC2.
Caspase 3 (CASP3) Rabbit Polyclonal Antibody
TA324396

USD 450.00

5 Days

Rabbit polyclonal CASP3 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 219-248 amino acids from the C-terminal region of human CASP3.
Cytochrome C (CYCS) Rabbit Polyclonal Antibody
TA325405

USD 345.00

4 Weeks

Rabbit Polyclonal Cytochrome c Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Cytochrome c.
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA327390

USD 345.00

3 Weeks

Rabbit anti-CASP9 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP9
Caspase 3 (CASP3) Rabbit Polyclonal Antibody
TA336323

USD 402.00

5 Days

Rabbit Polyclonal active/cleaved Caspase 3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human caspase-3 protein was used as immunogen.
Caspase 3 (CASP3) Mouse Monoclonal Antibody [Clone ID: 31A1067]
TA336455

USD 512.00

5 Days

Mouse Monoclonal Caspase-3 (Pro and Active) Antibody (31A1067)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
APAF1 Rabbit Polyclonal Antibody
TA305973

USD 430.00

5 Days

Rabbit Polyclonal Apaf1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Apaf1 antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human Apaf1. The sequence of the immunogenic peptide differs from that of murine Apaf1 by one amino acid .
POLR2G Rabbit Polyclonal Antibody
TA308043

USD 415.00

5 Days

Rabbit polyclonal antibody to POLR2G (polymerase (RNA) II (DNA directed) polypeptide G)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 122 of RNA polymerase IIG (Uniprot ID#P62487)
COX5B Rabbit Polyclonal Antibody
TA308206

USD 415.00

5 Days

Rabbit Polyclonal antibody to COX5B (cytochrome c oxidase subunit Vb)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 129 of COX5B (Uniprot ID#P10606)
AP2M1 Rabbit Polyclonal Antibody
TA308343

USD 415.00

5 Days

Rabbit Polyclonal antibody to AP2M1 (adaptor-related protein complex 2, mu 1 subunit)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 150 of AP2M1 (Uniprot ID#Q96CW1)
HDAC2 Rabbit Polyclonal Antibody
TA310002

USD 370.00

3 Weeks

Rabbit anti-HDAC2 (Phospho-Ser394) polyclonal antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antibody was produced against synthesized phosphopeptide derived from humanHDAC2 around the phosphorylation site of serine 394 (E-D-SP-G-D).
Modifications Phospho-specific
CREB3L1 Goat Polyclonal Antibody
TA311556

USD 375.00

5 Days

Goat Anti-OASIS / CREB3L1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DFSHSKEWFHDRD, from the C Terminus of the protein sequence according to NP_443086.1.
Cytochrome C (CYCS) Rabbit Polyclonal Antibody
TA312385

USD 345.00

4 Weeks

Rabbit polyclonal Cytochrome c antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cytochrome c.
HDAC2 Rabbit Polyclonal Antibody
TA313168

USD 345.00

4 Weeks

Rabbit polyclonal HDAC2 (Ab-394) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human HDAC2 around the phosphorylation site of Serine 394.
Phospholipase C beta 3 (PLCB3) Rabbit Polyclonal Antibody
TA314347

USD 345.00

4 Weeks

Rabbit polyclonal PLC-beta (Ser1105) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PLC-β around the phosphorylation site of serine 1105 (N-N-SP-I-S).
Modifications Phospho-specific
CREB1 Rabbit Polyclonal Antibody
TA319433

USD 530.00

5 Days

Rabbit polyclonal CREB phospho S133 antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CREB phospho peptide corresponding to amino acid residues 122-147 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).
Modifications Phospho-specific
BAX Rabbit Polyclonal Antibody
TA325255

USD 345.00

4 Weeks

Rabbit Polyclonal Bax Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Bax.
p53 (TP53) Rabbit Polyclonal Antibody
TA325949

USD 345.00

4 Weeks

Rabbit Polyclonal p53 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human p53.
CoREST (RCOR1) Mouse Monoclonal Antibody [Clone ID: S72-8]
TA326451

USD 410.00

5 Days

Mouse Monoclonal Anti-Co-Rest/RCOR1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
SOD2 Rabbit Polyclonal Antibody
TA327034

USD 345.00

3 Weeks

Rabbit anti-SOD2 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD2
SDHA Rabbit Polyclonal Antibody
TA332575

USD 345.00

3 Weeks

Rabbit anti-SDHA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SDHA
CREB1 Rabbit Polyclonal Antibody
TA333186

USD 345.00

3 Weeks

Phospho-CREB1-S142 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S142 of human CREB1
Modifications Phospho-specific
SLC25A4 Rabbit Polyclonal Antibody
TA334077

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLC25A4 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A4 Antibody: synthetic peptide directed towards the N terminal of human SLC25A4. Synthetic peptide located within the following region: LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA336326

USD 402.00

5 Days

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220).
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA336327

USD 402.00

5 Days

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220).
p53 (TP53) Rabbit Polyclonal Antibody
TA354205

USD 300.00

5 Days

Rabbit anti p53 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the N-terminus of human p53 protein
p53 (TP53) Rabbit Polyclonal Antibody
TA354509

USD 325.00

5 Days

Rabbit anti P53(pS15) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein
p53 (TP53) Rabbit Polyclonal Antibody
TA354572

USD 355.00

5 Days

Rabbit anti P53(pS37) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein