Primary Antibodies

View as table Download

Rabbit anti-ALDH2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2

Rabbit anti-ACAT1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACAT1

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Rabbit polyclonal antibody to PCCase beta (propionyl Coenzyme A carboxylase, beta polypeptide)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 167 and 480 of PCCB (Uniprot ID#P05166)

Mouse monoclonal ALDH2 Antibody

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Monoclonal Antibody against LDHA (Clone EP1563Y)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal antibody to SUCLG1 (succinate-CoA ligase, alpha subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 346 of SUCLG1 (Uniprot ID#P53597)

ACADM rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 196~225 amino acids from the Center region of Human ACADM.

ALDH2 (N-term) rabbit polyclonal antibody, Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 52-81 amino acids from the N-terminal region of human ALDH2.

Rabbit Polyclonal Antibody against ALDH2 (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-347 amino acids from the Central region of human ALDH2.

Rabbit polyclonal Acetyl-CoA Carboxylase (Ser80) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human: Ser80, Mouse: Ser79, Rat: Ser79
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human acetyl-CoA carboxylase around the phosphorylation site of serine 80 (S-M-SP-G-L).
Modifications Phospho-specific

Rabbit polyclonal Acetyl-CoA Carboxylase (Ab-80) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Acetyl-CoA Carboxylase around the phosphorylation site of serine 80 (S-M-SP-G-L).

Rabbit polyclonal anti-EHHADH antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human EHHADH.

Rabbit anti-LDHA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LDHA

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

Goat Polyclonal Anti-ALDH3A2 Antibody

Applications IHC
Reactivities Human (Expected from sequence similarity: Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-ALDH3A2 Antibody: Peptide with sequence C-SLKREGANKLRYPP, from the internal region of the protein sequence according to NP_001026976.1; NP_000373.1.

ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human ACAT1.
Epitope: Internal.

LDHA (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 161~190 amino acids from the Central region of Human LDHA

Rabbit Polyclonal Antibody against ALDH6A1 (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ALDH6A1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 367-396 amino acids from the C-terminal region of human ALDH6A1.

Rabbit polyclonal antibody to MCD (malonyl-CoA decarboxylase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 90 and 304 of (Uniprot ID#O95822)

Rabbit Polyclonal antibody to SUCLG2 (succinate-CoA ligase, GDP-forming, beta subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 234 of SUCLG2 (Uniprot ID#Q96I99)

Rabbit Polyclonal antibody to SUCLA2 (succinate-CoA ligase, ADP-forming, beta subunit)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 138 and 416 of SUCLA2 (Uniprot ID#Q9P2R7)

Rabbit polyclonal HADHA Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HADHA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 737-763 amino acids from the C-terminal region of human HADHA.

Rabbit Polyclonal Lactate Dehydrogenase A/LDHA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human Lactate Dehydrogenase A protein (within residues 280-332). [Swiss-Prot# P00338]

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide

MCEE (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 135-164 amino acids from the C-terminal region of Human MCEE

PCCA (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human PCCA

Goat Polyclonal Antibody against ACADM

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RLIVAREHIDKYKN, from the C Terminus of the protein sequence according to NP_000007.1.

Goat Anti-ALDH9A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QKEILDKFTEEVVKQ, from the internal region of the protein sequence according to NP_000687.3.

Goat Anti-ALDH6A1 (aa487-496) Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRSSFRGDTN, from the internal region of the protein sequence according to NP_005580.1.

Rabbit polyclonal ACC1 (Ser80) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human ACC1 around the phosphorylation site of serine 79 (S-M-SP-G-L).
Modifications Phospho-specific

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

LDHA mouse monoclonal antibody, clone n.a, Purified

Applications IHC
Reactivities Human

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2C11 (formerly 2C11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2B11 (formerly 2B11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI5G10 (formerly 5G10)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) LDHA mouse monoclonal antibody, clone OTI2D11 (formerly 2D11)

Applications IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated