Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Aggrecan Neoepitope Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Canine, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112] |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Mouse Monoclonal alpha Tubulin Antibody (DM1A) - Microtubule Marker
| Applications | IHC, WB |
| Reactivities | Bovine, Chicken, Guinea Pig, Human, Mouse, Porcine, Rat, Xenopus |
| Conjugation | Unconjugated |
Rabbit Polyclonal AGPAT6 Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human AGPAT6 protein sequence (between residues 400-456). [Swiss-Prot Q86UL3] |
Pancreatic alpha amylase (AMY2A) sheep polyclonal antibody, Ig Fraction
| Applications | ELISA, WB |
| Reactivities | Human, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Porcine pancreatic Alpha-Amylase |
USD 440.00
2 Weeks
Rabbit Polyclonal Antibody against SAT1
| Applications | WB |
| Reactivities | Human, Mouse, Porcine, Xenopus, Hamster, Cow, Rat, Chicken |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region within residues 100-171 of the human protein. [Swiss-Prot# P21673] |
Mouse monoclonal anti-ATP1A1(NaK ATPase) antibody, clone 464.6, Loading control
| Applications | FC, IHC, WB |
| Reactivities | Canine, Human, Mouse, Porcine, Primate, Rabbit, Rat, Sheep, Xenopus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Ki-67/MKI67 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of human Ki67 (within residues 1550-1700) [Swiss-Prot# P46013] |
TA336650 is a possible alternative to TA336566.
Rabbit Polyclonal Antibody against UCHL1 (PGP9.5) - Neuronal Marker - Neuronal Marker
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Monkey, Rat, Porcine, Horse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal portion of the human UCHL1 protein (between residues 200-223). [UniProt# P09936] |
Albumin porcine, mouse anti porcine, clone PAL17
| Applications | ELISA, IHC, WB |
| Reactivities | Porcine |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against PTGDS
| Applications | WB |
| Reactivities | Human, Primate, Mouse, Rat, Bovine, Porcine, Feline, Equine, Dog |
| Conjugation | Unconjugated |
| Immunogen | The epitope recognized by this antibody maps to region within residue 1-50 of human PTGDS. [Swiss-Prot# P41222] |
Rabbit Polyclonal SREBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
Mouse Monoclonal Beclin 1/ATG6 Antibody (9B6)
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Equine, Porcin |
| Conjugation | Unconjugated |
Rabbit Polyclonal MUC-1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL. |
Transferrin (TF) (N-term) mouse monoclonal antibody, clone HTF-14, Aff - Purified
| Applications | ELISA, FN, IF, WB |
| Reactivities | Human, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Antibody against VEGFA
| Applications | WB |
| Reactivities | Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692] |
Rabbit Polyclonal Antibody against LOX
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Porcine, Cow |
| Conjugation | Unconjugated |
| Immunogen | A cocktail of two synthetic peptides; one made to a region of the human LOX protein within residues 300-400 and one within residues 200-300 |
Rabbit Polyclonal anti-CALR Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
USD 424.00
In Stock
Rabbit Polyclonal Pyruvate Carboxylase Antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498] |
Rabbit Polyclonal Perilipin Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Mouse Monoclonal VEGF Antibody (VG76e)
| Applications | IHC, WB |
| Reactivities | Human, Bovine, Porcine, Sheep |
| Conjugation | Unconjugated |
Rabbit Polyclonal LC3/MAP1LC3A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a C-terminal region of the human LC3 protein (within residues 50-120). [Swiss-Prot Q9H492] |
Cardiac Troponin I (TNNI3) mouse monoclonal antibody, clone 810
| Applications | ELISA, IP, WB |
| Reactivities | Bovine, Canine, Feline, Goat, Human, Porcine, Rabbit |
| Conjugation | Unconjugated |
GAPDH mouse monoclonal antibody, clone 4G5
| Applications | ELISA, IF, WB |
| Reactivities | Bovine, Feline, Goat, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Rabbit Polyclonal anti-CANX Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Bovine, Chicken, Dog, Guinea Porcine, Hamster, Porcine, Monkey, Rabbit, Sheep, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | A 19 residue synthetic peptide based on canine calnexin and the peptide coupled to KLH. |
Active filters
Filter by
Target Symbol
- CANX (4)
- GAPDH (4)
- DCX (3)
- HIF1A (3)
- BECN1 (2)
- HNRNPM (2)
- KCNA2 (2)
- LOX (2)
- NEFH (2)
- UCHL1 (2)
- VEGFA (2)
- A2M (1)
- ACAN (1)
- ACAT1 (1)
- ACAT2 (1)
- ACTB (1)
- ALB (1)
- AQP2 (1)
- ATG5 (1)
- ATP1A1 (1)
- ATP1B1 (1)
- BCL2L1 (1)
- BEST1 (1)
- BRONCHIAL BASEMENT CELLS (1)
- CALR (1)
- CELF1 (1)
- CUEDC2 (1)
- DUOX2 (1)
- EGR2 (1)
- FASN (1)
- FLI1 (1)
- GKN1 (1)
- GNAS (1)
- GPAT4 (1)
- HSPA1A (1)
- IFRD1 (1)
- KDELR1 (1)
- LCN2 (1)
- LRRK2 (1)
- MAP1LC3B (1)
- MKI67 (1)
- MUC1 (1)
- NEFL (1)
- NEFM (1)
- NFKBIA (1)
- NPC1 (1)
- PC (1)
- PDIA3 (1)
- PIK3C3 (1)
- PLIN1 (1)
- PLIN2 (1)
- PLIN3 (1)
- PLK1 (1)
- PRDM1 (1)
- PTGDS (1)
- RBFOX3 (1)
- SAG (1)
- SAT1 (1)
- SF3B4 (1)
- SIAH1 (1)
- SOX2 (1)
- SREBF1 (1)
- STX1A (1)
- SYCP3 (1)
- TIMP2 (1)
- TLR5 (1)
- TUBA1A (1)
- TUBB (1)
- UBB (1)
- VAMP1 (1)
- VIM (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Assay Types
Families
- Druggable Genome (58)
- Transmembrane (20)
- Secreted Protein (11)
- ES Cell Differentiation/IPS (10)
- Transcription Factors (9)
- Ion Channels: Potassium (2)
- Protease (2)
- Protein Kinase (2)
- Adult stem cells (1)
- Cancer stem cells (1)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)
- Ion Channels: Other (1)
Pathways
- Metabolic pathways (12)
- Antigen processing and presentation (7)
- Pathways in cancer (7)
- Amyotrophic lateral sclerosis (ALS) (5)
- Renal cell carcinoma (5)
- mTOR signaling pathway (5)
- Alzheimer's disease (4)
- Glycolysis / Gluconeogenesis (4)
- Parkinson's disease (4)
- Pathogenic Escherichia coli infection (4)
- Regulation of autophagy (4)
- Spliceosome (4)
- Focal adhesion (3)
- Gap junction (3)
- Pancreatic cancer (3)
- Pyruvate metabolism (3)
- Vibrio cholerae infection (3)
- Apoptosis (2)
- Bladder cancer (2)
- Butanoate metabolism (2)
- Cardiac muscle contraction (2)
- Chronic myeloid leukemia (2)
- Cytokine-cytokine receptor interaction (2)
- Dilated cardiomyopathy (2)
- Fatty acid metabolism (2)
- Insulin signaling pathway (2)
- Lysine degradation (2)
- Propanoate metabolism (2)
- RIG-I-like receptor signaling pathway (2)
- SNARE interactions in vesicular transport (2)
- Small cell lung cancer (2)
- Synthesis and degradation of ketone bodies (2)
- Terpenoid backbone biosynthesis (2)
- Toll-like receptor signaling pathway (2)
- Tryptophan metabolism (2)
- VEGF signaling pathway (2)
- Valine (2)
- leucine and isoleucine degradation (2)
- Adherens junction (1)
- Adipocytokine signaling pathway (1)
- Arachidonic acid metabolism (1)
- Arginine and proline metabolism (1)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (1)
- B cell receptor signaling pathway (1)
- Calcium signaling pathway (1)
- Cell cycle (1)
- Chemokine signaling pathway (1)
- Citrate cycle (TCA cycle) (1)
- Cytosolic DNA-sensing pathway (1)
- Endocytosis (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Ether lipid metabolism (1)
- Fatty acid biosynthesis (1)
- Glycerolipid metabolism (1)
- Glycerophospholipid metabolism (1)
- GnRH signaling pathway (1)
- Hypertrophic cardiomyopathy (HCM) (1)
- Inositol phosphate metabolism (1)
- Jak-STAT signaling pathway (1)
- Leukocyte transendothelial migration (1)
- Long-term depression (1)
- Lysosome (1)
- MAPK signaling pathway (1)
- Melanogenesis (1)
- NOD-like receptor signaling pathway (1)
- Neurotrophin signaling pathway (1)
- Oocyte meiosis (1)
- PPAR signaling pathway (1)
- Phosphatidylinositol signaling system (1)
- Prion diseases (1)
- Progesterone-mediated oocyte maturation (1)
- Prostate cancer (1)
- Regulation of actin cytoskeleton (1)
- T cell receptor signaling pathway (1)
- Taste transduction (1)
- Tight junction (1)
- Ubiquitin mediated proteolysis (1)
- Vascular smooth muscle contraction (1)
- Viral myocarditis (1)
- Wnt signaling pathway (1)
- p53 signaling pathway (1)