Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-PRKAA2 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRKAA2 antibody: synthetic peptide directed towards the middle region of human PRKAA2. Synthetic peptide located within the following region: AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP |
Rabbit Polyclonal antibody to AMPK alpha 2 (protein kinase, AMP-activated, alpha 2 catalytic subunit)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 29 and 510 of AMPK alpha 2 (Uniprot ID#P54646) |
Rabbit polyclonal APG1 (ULK1) Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1). |
Anti-PRKAA1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to N terminal 14 amino acids of human protein kinase, AMP-activated, alpha 1 catalytic subunit |
AMPK alpha 1 (PRKAA1) pSer487 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AMPK alpha-1 around the phosphorylation site of serine 487 (S-G- SP-V-S). |
AMPK alpha 1 (PRKAA1) pSer487 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AMPK alpha-1 around the phosphorylation site of serine 487 (S-G- SP-V-S). |
Rabbit Polyclonal antibody to PIK3R4 (phosphoinositide-3-kinase, regulatory subunit 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 381 of PIK3R4 (Uniprot ID#Q99570) |
Rabbit anti-PRKAA2 (AMPK1/AMPK2, Phospho-Ser485/Ser491) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanAMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G- SP-V-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal ULK2 Antibody (Center S323)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ULK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-327 amino acids from the Central region of human ULK2. |
Rabbit Polyclonal AMPK1 (Ser485) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 around the phosphorylation site of Serine 485 |
| Modifications | Phospho-specific |
Rabbit Polyclonal AMPK alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha |
Rabbit Polyclonal Phospho-AMPK alpha (Thr172) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha around the phosphorylation site of Threonine 172 |
| Modifications | Phospho-specific |
Goat Polyclonal Antibody against ULK3 (aa445-458)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KMRESRWEADTLDK, from the C Terminus of the protein sequence according to NP_001092906.1. |
Rabbit Polyclonal Anti-PIK3R4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIK3R4 antibody: synthetic peptide directed towards the N terminal of human PIK3R4. Synthetic peptide located within the following region: HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL |
Rabbit Polyclonal Anti-ULK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL |
Rabbit anti AMPKa(pS79) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -CGSPN- with a phosphorylation site at Ser79 of AMPK alpha 1 protein from Carassius Auratus origin. This sequence is identical among human, mouse, rat, chicken, bovine, dog, and insect species. |
Rabbit anti AMPK-alpha(pT172) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Rabbit anti AMPK-alpha Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat, Mouse, Bovine, Chicken, Dog |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -LRTSC- with a phosphorylation site at Thr 172 of AMPK alpha protein from human origin |
Goat Anti-PRKAA2, Biotinylated Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CPLDALNTTKP., from the internal region of the protein sequence according to NP_006243.2. |
Anti-PRKAA2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 16-268 amino acids of human protein kinase, AMP-activated, alpha 2 catalytic subunit |
ULK3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ULK3 |
Active filters
Applications
- WB
Families
- Protein Kinase
Pathways
- Regulation of autophagy