Germany
Japan
United Kingdom
China
TNF alpha (TNF) mouse monoclonal antibody, clone Mab1, Purified
| Applications | ELISA, FN, WB |
| Reactivities | Human |
Primary Antibodies
View as table DownloadPerforin (PRF1) mouse monoclonal antibody, clone B-D48, Azide Free
| Applications | FC, IHC, WB |
| Reactivities | Human |
IL2 mouse monoclonal antibody, clone B-G5, Azide Free
| Applications | FC, FN, WB |
| Reactivities | Human |
IL6 goat polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) recombinant human IL-6 |
IL6 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, FN, WB |
| Reactivities | Chicken |
| Immunogen | Recombinant Chicken IL-6. |
Rabbit polyclonal anti-HLA-DOA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HLA-DOA. |
Rabbit polyclonal anti-HA2Q antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human HA2Q. |
Rabbit polyclonal CD28 Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD28 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-208 amino acids from the C-terminal region of human CD28. |
Mouse monoclonal HLA-G Antibody(Ascites)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-B Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-90 amino acids from the N-terminal region of human HLA-B. |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT |
Rabbit Polyclonal Anti-CD80 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | CD80 antibody was raised against a peptide corresponding to 17 amino acids near the amino terminus of human CD80. The immunogen is located within amino acids 60 - 110 of CD80. |
Rabbit Polyclonal Anti-CD86 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CD86 antibody was raised against a peptide corresponding to 17 amino acids near the center of human CD86. The immunogen is located within amino acids 160 - 210 of CD86. |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GC8
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GF1
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone G-23, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 165, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 3F1E3, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
IL6 mouse monoclonal antibody, clone B-F6, Azide Free
| Applications | IP, WB |
| Reactivities | Human |
IL6 mouse monoclonal antibody, clone AT1F10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
IL6 mouse monoclonal antibody, clone AT1F10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
Interferon gamma (IFNG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly purified recombinant Inferferon gamma. |
IL6 goat polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly pure (> 98%) recombinant human IL-6 |
Goat Anti-CD28 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence SQQLQVYSKTGFNCD, from the internal region of the protein sequence according to NP_006130.1. |
Rabbit polyclonal anti-KLRC1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KLRC1. |
Rabbit polyclonal anti-IL-2 antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | E. coli expressed human IL-2 |
Mouse monoclonal HLA-G Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KIR2DL5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIR2DL5A antibody is: synthetic peptide directed towards the C-terminal region of Human KIR2DL5A. Synthetic peptide located within the following region: QLDHCVFTQTKITSPSQRPKTPPTDTTMYMELPNAKPRSLSPAHKHHSQA |
Active filters
Applications
- WB
Pathways
- Graft-versus-host disease
Filter by
Category
Target Symbol
- CD80 (88)
- CD86 (57)
- TNF (38)
- IL1A (32)
- IL6 (31)
- IFNG (26)
- IL2 (21)
- CD28 (19)
- FAS (17)
- HLA-A (17)
- IL1B (17)
- SMURF2 (17)
- GZMB (13)
- HLA-DQA2 (13)
- FASLG (6)
- HLA-DRB5 (6)
- KLRC1 (6)
- HLA-G (5)
- KIR2DL3 (4)
- KIR3DL1 (4)
- PRF1 (4)
- HLA-DMB (3)
- HLA-DRA (3)
- KLRD1 (3)
- HLA-B (2)
- HLA-DMA (2)
- HLA-DOA (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-DRB3 (2)
- HLA-E (2)
- HLA-F (2)
- KIR2DL1 (2)
- HLA-C (1)
- HLA-DQA1 (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)
- KIR2DL5A (1)
- KIR3DL2 (1)