Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to PIK3R4 (phosphoinositide-3-kinase, regulatory subunit 4)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 381 of PIK3R4 (Uniprot ID#Q99570) |
Rabbit anti-PRKAA2 (AMPK1/AMPK2, Phospho-Ser485/Ser491) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanAMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G- SP-V-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-ATG4D antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ATG4D. |
Rabbit polyclonal ATG7 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATG7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 494-523 amino acids from human ATG7. |
Rabbit polyclonal ATG7 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ATG7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 540-569 amino acids from the C-terminal region of human ATG7. |
Rabbit polyclonal ULK2 Antibody (Center S323)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ULK2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 300-327 amino acids from the Central region of human ULK2. |
Rabbit Polyclonal AMPK1 (Ser485) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK1 around the phosphorylation site of Serine 485 |
| Modifications | Phospho-specific |
Rabbit Polyclonal AMPK alpha Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha |
Rabbit Polyclonal Anti-GABARAPL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GABARAPL1 Antibody: synthetic peptide directed towards the middle region of human GABARAPL1. Synthetic peptide located within the following region: KAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTI |
Rabbit Polyclonal Anti-ATG5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GC8
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GF1
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone G-23, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 165, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 3F1E3, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Insulin (INS) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly purified recombinant Inferferon gamma. |
Rabbit Polyclonal Phospho-AMPK alpha (Thr172) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha around the phosphorylation site of Threonine 172 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GABARAPL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GABARAPL1 Antibody: synthetic peptide directed towards the N terminal of human GABARAPL1. Synthetic peptide located within the following region: MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL |
Rabbit Polyclonal Anti-ATG4B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-APG4B Antibody: synthetic peptide directed towards the C terminal of human APG4B. Synthetic peptide located within the following region: LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL |
ATG5 (incl. pos. control) mouse monoclonal antibody, clone 11C3, Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
Beclin 1 (BECN1) mouse monoclonal antibody, clone 12B4, Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
GABARAP rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal antibody to Interferon alpha-6 (interferon, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 125 and 189 of interferon alpha 6 (Uniprot ID#P05013) |
Goat Polyclonal Antibody against ULK3 (aa445-458)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KMRESRWEADTLDK, from the C Terminus of the protein sequence according to NP_001092906.1. |
Goat Polyclonal Anti-ATG4C Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | C- terminus of NP_116241.2; NP_835739.1 (EDEKKQLKRFSTEE) |
Rabbit polyclonal IFNA4 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4. |
Active filters
Applications
- WB
Pathways
- Regulation of autophagy
Filter by
Category
Target Symbol
- BECN1 (56)
- ATG3 (38)
- IFNG (26)
- PRKAA1 (17)
- ATG4B (15)
- ATG5 (10)
- ATG4A (7)
- GABARAP (7)
- IFNA2 (7)
- PRKAA2 (7)
- IFNA6 (6)
- ATG4C (5)
- ULK1 (5)
- ATG12 (4)
- ATG7 (4)
- PIK3C3 (4)
- ATG4D (3)
- INS (3)
- PIK3R4 (3)
- ULK2 (3)
- ULK3 (3)
- BECLIN 1 (2)
- GABARAPL1 (2)
- GABARAPL2 (2)
- IFNA16 (2)
- IFNA4 (2)
- IFNA13 (1)
- IFNA5 (1)
- IFNA7 (1)
- IFNA8 (1)