Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-APOA5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human APOA5. |
Primary Antibodies
View as table Download
Rabbit polyclonal MMP1 (Cleaved-Phe100) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP1. |
Rabbit polyclonal Cytochrome P450 4A11/22 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYTOCHROME P450 4A11/22. |
Rabbit polyclonal Cytochrome P450 27A1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 27A1. |
Rabbit polyclonal anti-GLPK2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLPK2. |
Rabbit polyclonal anti-LOX-1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide near the N-terminus of human Lox-1 |
Rabbit polyclonal anti-FABP5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human FABP-5 |
Anti-PPARA Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of human peroxisome proliferator-activated receptor alpha |
Rabbit polyclonal MMP1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MMP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 317-347 amino acids from the Central region of human MMP1. |
Rabbit polyclonal FADS2 Antibody (Center)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FADS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 96-122 amino acids from the Central region of human FADS2. |
Rabbit polyclonal CYP8B1 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CYP8B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 471-501 amino acids from the C-terminal region of human CYP8B1. |
Rabbit Polyclonal PDK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 |
Rabbit Polyclonal PDK1 (Ser241) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PDK1 around the phosphorylation site of Serine 241 |
| Modifications | Phospho-specific |
Rabbit Polyclonal PPAR-gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PPAR-gamma |
Rabbit Polyclonal Anti-ACSL1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL1 antibody: synthetic peptide directed towards the N terminal of human ACSL1. Synthetic peptide located within the following region: ALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSY |
Rabbit Polyclonal Anti-ACADM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACADM antibody: synthetic peptide directed towards the N terminal of human ACADM. Synthetic peptide located within the following region: ATARKFAREEIIPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLG |
Rabbit Polyclonal Anti-PCK1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCK1 antibody: synthetic peptide directed towards the middle region of human PCK1. Synthetic peptide located within the following region: NGFFGVAPGTSVKTNPNAIKTIQKNTIFTNVAETSDGGVYWEGIDEPLAS |
Rabbit Polyclonal Anti-SLC27A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC27A2 Antibody: synthetic peptide directed towards the N terminal of human SLC27A2. Synthetic peptide located within the following region: LLFRDETLTYAQVDRRSNQVARALHDHLGLRQGDCVALLMGNEPAYVWLW |
Rabbit Polyclonal Anti-ACSL5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACSL5 antibody: synthetic peptide directed towards the C terminal of human ACSL5. Synthetic peptide located within the following region: ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG |
Rabbit Polyclonal SCD5 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal PDPK1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
PPAR alpha (PPARA) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
liver FABP (FABP1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human FABP1 |
FABP4 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human FABP4 |
MMP1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human |
| Immunogen | MMP1 antibody was raised against a synthetic peptide from near C-terminal of human MMP-1 protein. |
Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human |
| Immunogen | C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Goat Polyclonal Antibody against NR1H3; NR1H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRLQDKKLPPLLSEI, from the internal region of the protein sequence according to NP_005684; NP_009052. |
Rabbit polyclonal antibody to ILBP (fatty acid binding protein 6, ileal (gastrotropin))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 142 of FABP6 (Uniprot ID#P51161 isoform2) |
Rabbit anti-PPARG polyclonal antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein |
Rabbit polyclonal ILK (Ab-246) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human ILK around the phosphorylation site of serine 246 (I-F-SP-H-P). |
Rabbit polyclonal MMP1 (Cleaved-Pro269) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP1. |
Active filters
Clonalities
- Polyclonal
Pathways
- PPAR signaling pathway
Filter by
Category
Target Symbol
- PPARG (13)
- MMP1 (12)
- PLIN1 (12)
- PPARD (11)
- NR1H3 (10)
- PCK1 (10)
- PPARA (10)
- PDPK1 (9)
- APOA1 (8)
- ME1 (8)
- RXRB (7)
- ACOX2 (6)
- ANGPTL4 (6)
- CPT1A (6)
- FABP2 (6)
- FABP4 (6)
- GK (6)
- ILK (6)
- OLR1 (6)
- RXRA (6)
- RXRG (6)
- SCD (6)
- ACADM (5)
- ADIPOQ (5)
- CD36 (5)
- CPT1B (5)
- FABP1 (5)
- FABP3 (5)
- FABP7 (5)
- GK2 (5)
- UCP1 (5)
- ACOX3 (4)
- ACSL1 (4)
- ACSL4 (4)
- CYP27A1 (4)
- HMGCS2 (4)
- PLTP (4)
- SCP2 (4)
- ACADL (3)
- ACSL5 (3)
- ACSL6 (3)
- APOA2 (3)
- APOA5 (3)
- CPT1C (3)
- CPT2 (3)
- CYP4A11 (3)
- CYP8B1 (3)
- DBI (3)
- EHHADH (3)
- FABP5 (3)
- SCD5 (3)
- SLC27A4 (3)
- SLC27A5 (3)
- ACOX1 (2)
- ACSL3 (2)
- AQP7 (2)
- CYP4A22 (2)
- FABP6 (2)
- FADS2 (2)
- PCK2 (2)
- SLC27A1 (2)
- SLC27A2 (2)
- SLC27A6 (2)
- SORBS1 (2)
- UBC (2)
- ACAA1 (1)
- APOC3 (1)
- CYP7A1 (1)
- LPL (1)