Rabbit Polyclonal Anti-DVL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Rabbit Polyclonal Anti-SKIIP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SKIIP antibody: synthetic peptide directed towards the N terminal of human SKIIP. Synthetic peptide located within the following region: RQGQSKDKVIYSKYTDLVPKEVMNADDPDLQRPDEEAIKEITEKTRVALE |
Rabbit Polyclonal Anti-CTBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
Rabbit Polyclonal Anti-CREBBP Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CREBBP Antibody: synthetic peptide directed towards the N terminal of human CREBBP. Synthetic peptide located within the following region: TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS |
Rabbit Polyclonal Anti-PSEN2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSEN2 antibody: synthetic peptide directed towards the N terminal of human PSEN2. Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV |
Rabbit Polyclonal Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
Rabbit Polyclonal Anti-CTBP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the C terminal of human CTBP2. Synthetic peptide located within the following region: TGRIPESLRNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVA |
Rabbit Polyclonal Anti-CTBP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP2 antibody: synthetic peptide directed towards the middle region of human CTBP2. Synthetic peptide located within the following region: APGGLPAAMEGIIPGGIPVTHNLPTVAHPSQAPSPNQPTKHGDNREHPNE |
Rabbit Polyclonal Anti-DLL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC |
Goat Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3. |
Goat Anti-MAML1 / Mastermind Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence VLPTCPMAEFALPR, from the N Terminus of the protein sequence according to NP_055572.1. |
Rabbit Polyclonal APH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | APH1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human APH1a. |
Goat Anti-NOTCH3 Antibody
| Applications | IHC |
| Reactivities | Expected from seq similarity: Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QLGPQPEVTPKRQ, from the C Terminus of the protein sequence according to NP_000426.2. |
Rabbit polyclonal anti-CtBP2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CtBP2. |
Rabbit polyclonal anti-DVL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
Rabbit polyclonal anti-GCN5L2 / KAT2A antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GCN5L2. |
Rabbit polyclonal anti-MFNG antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MFNG. |
Rabbit polyclonal NOTCH2 (Cleaved-Val1697) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human NOTCH2. |
Rabbit polyclonal anti-Dvl3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 583 of mouse Dvl3 |
Rabbit polyclonal anti-TCR alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 138 of human TCRa |
Rabbit polyclonal anti-Notch 1 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Notch antibody was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues 2488-2502 of human Notch 1. A residue of cysteine was added to the amino terminal end to facilitate coupling. |
Anti-NUMBL Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 280 amino acids of human numb homolog (Drosophila)-like |
Rabbit polyclonal HDAC1 Antibody(C-term)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 421-450 amino acids from the C-terminal region of human HDAC1. |
Mouse monoclonal HDAC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal HDAC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human HDAC1. |
Rabbit Polyclonal HDAC2 (Ser394) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human HDAC2 around the phosphorylation site of Sersine 394. |
| Modifications | Phospho-specific |
Rabbit Polyclonal p300/CBP Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human PCAF. |
Goat Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KNTNQKKELEVDC, from the internal region of the protein sequence according to NP_061947.1. |
NCSTN Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NCSTN |
Dvl1 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Pig |
| Conjugation | Unconjugated |
| Immunogen | N Terminus (KLPVAPERVTLAD) |
Mouse monoclonal anti-HDAC2 antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NOTCH4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH4 antibody: synthetic peptide directed towards the middle region of human NOTCH4. Synthetic peptide located within the following region: KALKPKAEVDEDGVVMCSGPEEGEEVGQAEETGPPSTCQLWSLSGGCGAL |
Rabbit Polyclonal Anti-DVL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the C terminal of human DVL1. Synthetic peptide located within the following region: AAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPP |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ |
Rabbit Polyclonal Anti-DTX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DTX2 antibody: synthetic peptide directed towards the C terminal of human DTX2. Synthetic peptide located within the following region: EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE |
Rabbit Polyclonal Anti-NCOR2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NCOR2 antibody: synthetic peptide directed towards the N terminal of human NCOR2. Synthetic peptide located within the following region: PMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE |
Rabbit Polyclonal Anti-PCAF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCAF antibody: synthetic peptide directed towards the N terminal of human PCAF. Synthetic peptide located within the following region: LFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAK |
Rabbit Polyclonal Anti-CTBP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the C terminal of human CTBP1. Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
Rabbit Polyclonal Anti-CTBP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTBP1 antibody: synthetic peptide directed towards the N terminal of human CTBP1. Synthetic peptide located within the following region: TREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADS |
Rabbit polyclonal Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE |
Rabbit polyclonal Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF |
Rabbit Polyclonal Anti-NOTCH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 antibody: synthetic peptide directed towards the middle region of human NOTCH2. Synthetic peptide located within the following region: FPASVGKYPTPPSQHSYASSNAAERTPSHSGHLQGEHPYLTPSPESPDQW |
Rabbit Polyclonal Anti-Dtx3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Dtx3 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL |
Germany
Japan
United Kingdom
China
