Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Primary Antibodies
Download
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR094F2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Rabbit monoclonal anti-Sox2 Antibody, clone OTIR102D11
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Anti-HES1 mouse mAb, clone OTI4H1, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE |
CD4 mouse monoclonal antibody, clone B-A1, Azide Free
| Applications | FC, FN, IHC |
| Reactivities | Human |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
EGF mouse monoclonal antibody, clone S-21, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within 50 to 235 aa, corresponding to the external domain of human CD4 produced in E. coli. |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-BMP6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the N terminal of human BMP6. Synthetic peptide located within the following region: DGGSPGRTEQPPPSPQSSSGFLYRRLKTQEKREMQKEILSVLGLPHRPRP |
Chicken Anti-Microtubule Associated Protein 2 (MAP2) Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Bovine MAP2 isolated from brain by the GTP microtubule cycling method |
Active filters
Families
- Adult stem cells
Filter by
Target Symbol
- CD4 (232)
- EGFR (207)
- GLI1 (151)
- CD44 (105)
- KIT (93)
- FGF21 (75)
- ERBB3 (73)
- CD8A (68)
- CD34 (65)
- APOE (58)
- GATA3 (54)
- TAL1 (52)
- HES1 (50)
- HDAC1 (49)
- CD14 (47)
- CDX2 (47)
- EGF (38)
- IGFBP1 (34)
- MAP2 (32)
- HGF (31)
- NOTCH1 (28)
- POU5F1 (27)
- SOX9 (27)
- BMP6 (25)
- ZFP42 (25)
- SOX2 (24)
- GLI2 (22)
- BMP4 (21)
- PAX7 (18)
- SMURF2 (18)
- CD9 (15)
- GATA1 (15)
- FGF4 (13)
- BDNF (12)
- KLF4 (12)
- LEF1 (11)
- PAX3 (11)
- WNT1 (10)
- DKK1 (9)
- HNF1A (9)
- IGFBP2 (9)
- SOX1 (9)
- BMP2 (8)
- NEUROD1 (8)
- WNT3A (8)
- SFRP1 (7)
- ADGRE5 (6)
- BMP7 (6)
- FGF7 (6)
- WNT6 (6)
- BMP5 (5)
- BMP8B (5)
- DKK2 (5)
- LIF (5)
- PAX6 (5)
- PDGFC (5)
- WNT2 (5)
- BMP15 (4)
- CCN4 (4)
- CD72 (4)
- DKK4 (4)
- FGF10 (4)
- WNT5A (4)
- GDF3 (3)
- GDF9 (3)
- GLI3 (3)
- SFRP5 (3)
- SOX10 (3)
- DLL1 (2)
- FGF19 (2)
- GATA2 (2)
- GDF5 (2)
- GDF7 (2)
- SFRP4 (2)
- WNT7B (1)
Reactivities
- Human (1815)
- Mouse (963)
- Rat (870)
- Dog (60)
- Monkey (51)
- Bovine (14)
- Cow (11)
- Pig (10)
- Chicken (7)
- Primate (5)
- Rabbit (4)
- Canine (3)
- Feline (3)
- Xenopus (3)
- Bat (2)
- Chimpanzee (2)
- Hamster (2)
- Horse (2)
- Macaque (2)
- Sheep (2)
- Canis (1)
- Fish (1)
- Gibbon (1)
- Goat (1)
- Gorilla (1)
- Guinea Pig (1)
- Opossum (1)
- Porcine (1)
- Quail (1)
- X. tropicalis (1)
- Zebrafish (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Pathways in cancer (768)
- Hematopoietic cell lineage (633)
- Endocytosis (437)
- MAPK signaling pathway (404)
- Regulation of actin cytoskeleton (397)
- Cytokine-cytokine receptor interaction (395)
- Cell adhesion molecules (CAMs) (383)
- Melanoma (381)
- Antigen processing and presentation (318)
- ErbB signaling pathway (318)
- Primary immunodeficiency (300)
- T cell receptor signaling pathway (300)
- Focal adhesion (281)
- Calcium signaling pathway (280)
- Hedgehog signaling pathway (280)
- Prostate cancer (261)
- Endometrial cancer (256)
- Basal cell carcinoma (250)
- Gap junction (250)
- Bladder cancer (245)
- Glioma (245)
- Non-small cell lung cancer (245)
- Pancreatic cancer (245)
- Dorso-ventral axis formation (235)
- Adherens junction (218)
- Colorectal cancer (218)
- Epithelial cell signaling in Helicobacter pylori infection (207)
- GnRH signaling pathway (207)
- Melanogenesis (146)
- Notch signaling pathway (129)
- Acute myeloid leukemia (112)
- ECM-receptor interaction (105)
- TGF-beta signaling pathway (92)
- Wnt signaling pathway (75)
- Maturity onset diabetes of the young (72)
- Huntington's disease (61)
- Alzheimer's disease (58)
- Cell cycle (49)
- Chronic myeloid leukemia (49)
- Pathogenic Escherichia coli infection (47)
- Toll-like receptor signaling pathway (47)
- Renal cell carcinoma (31)
- Prion diseases (28)
- Allograft rejection (18)
- Autoimmune thyroid disease (18)
- Graft-versus-host disease (18)
- Type I diabetes mellitus (18)
- Ubiquitin mediated proteolysis (18)
- Viral myocarditis (18)
- Neurotrophin signaling pathway (12)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (11)
- Thyroid cancer (11)
- Jak-STAT signaling pathway (5)
- B cell receptor signaling pathway (4)