Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-ATG5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
Rabbit Polyclonal Beclin 1/ATG6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Canine, Porcine, Primate |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457] |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GC8
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone GF1
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone G-23, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 165, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 3F1E3, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Interferon gamma (IFNG) mouse monoclonal antibody, clone B-B1, Azide Free
| Applications | FC, FN |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 45-14, APC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | APC |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 45-14, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 45-14, Aff - Purified
| Applications | FC, IF |
| Reactivities | Human |
USD 1,160.00
2 Weeks
Interferon gamma (IFNG) mouse monoclonal antibody, clone 45-14, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
Insulin (INS) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Hamster, Human, Porcine, Rat |
| Immunogen | Synthetic Human proinsulin |
Interferon gamma (IFNG) rabbit polyclonal antibody, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
| Immunogen | Highly purified recombinant Inferferon gamma. |
Rabbit Polyclonal Phospho-AMPK alpha (Thr172) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AMPK alpha around the phosphorylation site of Threonine 172 |
| Modifications | Phospho-specific |
Mouse Monoclonal Anti-IFN-gamma Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 3A6
| Applications | ELISA |
| Reactivities | Bovine, Human, Porcine |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 7F8
| Applications | ELISA |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 8E2
| Applications | ELISA |
| Reactivities | Bovine, Human, Porcine |
| Conjugation | Unconjugated |
Insulin (INS) (beta chain) mouse monoclonal antibody, clone C7C9
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Interferon gamma (IFNG) mouse monoclonal antibody, clone 23, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
ATG5 (incl. pos. control) mouse monoclonal antibody, clone 11C3, Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
Beclin 1 (BECN1) mouse monoclonal antibody, clone 12B4, Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
Insulin (INS) mouse monoclonal antibody, clone ISL-8J, Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Interferon gamma (IFNG) mouse monoclonal antibody, clone B-B1, FITC
| Applications | FC |
| Conjugation | FITC |
Interferon gamma (IFNG) mouse monoclonal antibody, clone B-B1, PE
| Applications | FC |
| Conjugation | PE |
USD 630.00
2 Weeks
Insulin (INS) (+Proinsulin) (C-term) mouse monoclonal antibody, clone INSC7C9, Purified
| Applications | ELISA |
| Reactivities | Human |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G-Sp-V-S). |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AMPK1/AMPK2 around the phosphorylation site of serine 485/491 (S-G-Sp-V-S). |
AMPK alpha 1 (PRKAA1) pSer486 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic phosphopeptide derived from human AMPKα1 around the phosphorylation site of Serine 486. |
AMPK alpha 1 (PRKAA1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 470-520 of Human AMPKα1. |
Insulin (INS) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | C-Peptide conjugate EAEDLQVGQVKKKC- KLH |
Insulin (INS) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | C-Peptide conjugate EAEDLQVGQVKKKC- KLH |
GABARAP rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal antibody to Interferon alpha-6 (interferon, alpha 6)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 125 and 189 of interferon alpha 6 (Uniprot ID#P05013) |
Goat Polyclonal Antibody against ULK3 (aa445-458)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KMRESRWEADTLDK, from the C Terminus of the protein sequence according to NP_001092906.1. |
Rabbit polyclonal IFNA4 Antibody (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IFNA4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 162-189 amino acids from the C-terminal region of human IFNA4. |
Active filters
Families
- Druggable Genome
Pathways
- Regulation of autophagy