Primary Antibodies

View as table Download

Rabbit anti-CXCR3 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CXCR3

Rat Anti-Human CD197 (CCR7) Purified (100 ug)

Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal CX3CR1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1.

Rabbit Polyclonal CXCR4 Antibody

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4.

Rabbit Polyclonal CCR1 Antibody

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This antibody was raised against a synthetic peptide of human CCR1 protein.

CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Gorilla
Conjugation Unconjugated
Immunogen CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%).

Rabbit Polyclonal CCR3 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CCR3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human CCR3.

CXCR4 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4.

CCR4 mouse monoclonal antibody, clone KH-4F5, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

Rabbit Polyclonal CCR5 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5.

Rabbit Polyclonal Anti-CXCR4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4

CCR5 mouse monoclonal antibody, clone T21/8, Aff - Purified

Applications ELISA, FC, IHC, IP, WB
Reactivities Human

CCR4 (Extracell. Dom.) goat polyclonal antibody, Aff - Purified

Applications ELISA, FC, IHC, WB
Reactivities Human, Monkey
Immunogen Synthetic corresponding to Human CCR4 extracellular domain.
Epitope: Extracellular Domain.

Rabbit Polyclonal CX3CR1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Antibody was raised against a peptide corresponding to amino acids 2 to 21 of human CX3CR1. The sequence differs from those of mouse and rat CX3CR1 by four amino acids (NP_001328).

Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V).
Modifications Phospho-specific

Rabbit Polyclonal Anti-CXCR4 (extracellular)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)EGISIYTSDNYTEE,corresponding to amino acid residues 2-15 of human CXCR4. Extracellular, N-terminus.

CXCR4 Mouse Monoclonal Antibody, clone 772AA17

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772AA80

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 Mouse Monoclonal Antibody, clone 772AA101

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CXCR4 mouse monoclonal antibody, clone B-R24, Azide Free

Applications FC, FN
Reactivities Human

CX3CR1 (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A peptide corresponding to amino acids 2-21 of Human CX3CR1.

CXCR4 (14-40) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Sequence corresponding to the N-terminal extracellular domain of Mouse CXCR4 receptor. Epitope: aa14-40

CCR8 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 297-325 amino acids from the C-terminal region of human CCR8

Rabbit Polyclonal CX3CR1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CX3CR1 antibody was raised against a peptide corresponding to amino acids in a extracellular loop of human CX3CR1. The sequence is identical to that of rat CX3CR1 and differs from that of mouse CX3CR1 by one amino acid (3,4).

Rabbit Polyclonal Bonzo Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Bonzo antibody was raised against a peptide corresponding to amino acids near the amino terminus of human Bonzo/STRL33. The sequence of this peptide differs from those of African green monkey and pig-tailed macaque by one or two amino acids, respectively,.

CCR6 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Conjugation Unconjugated
Immunogen CCR6 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Horse (80%).

CCR4 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Conjugation Unconjugated
Immunogen CCR4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Panda, Dog (94%); Hamster, Elephant, Bovine, Horse (89%); Bat, Rabbit, Opossum (83%).

Anti-CCR3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 10-25 amino acids of human chemokine (C-C motif) receptor 3

Rabbit Polyclonal Anti-CXCR1 (extracellular)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide (C)SNITDPQMW DFDDLN, corresponding to aminoacid residues 2-16 of human CXCR1. Extracellular, N-terminus.

Rabbit Polyclonal Anti-CCR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL

Rabbit Polyclonal CXCR4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal region of the human CXCR4 protein (within residues 300-352). [Swiss-Prot P61073]

Rabbit Polyclonal Anti-CXCR3 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR3 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Goat, Panda (82%).

Rabbit Polyclonal Anti-IL8RB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF

Rabbit Polyclonal Anti-CCR7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR7 Antibody: A synthesized peptide derived from human CCR7

Rabbit Polyclonal Anti-CCR7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CCR7 Antibody: A synthesized peptide derived from human CCR7

Rabbit Polyclonal Anti-Phospho-CCR5(Ser349) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Phospho-CCR5(Ser349) Antibody: A synthesized peptide derived from human CCR5 around the phosphorylation site of Sersine 349
Modifications Phospho-specific

Rabbit Polyclonal CXCR4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

CXCR4 Mouse Monoclonal Antibody, clone 772X132

Applications Assay, FC
Reactivities Human

CXCR4 Mouse Monoclonal Antibody, clone 772X122

Applications Assay, FC
Reactivities Human
Conjugation Unconjugated

CCR3 (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to acetylated N-terminal sequence of sheep 14-3-3 epsilon. ( N-TERMINAL )

CXCR2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human
Immunogen Synthetic peptide mapping at the middle region of human CXCR2

CCR5 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the N-terminal of Human CCR5

CCR6 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human CCR6

CXCR3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 147-175 amino acids from the Central region of Human CXCR3

Rabbit Polyclonal CXCR4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4.

Rabbit Polyclonal CXCR4-Lo Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a.

Rabbit polyclonal CCR5 (Ser349) antibody(Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 349 (E-I-SP-V-G).
Modifications Phospho-specific

Rabbit polyclonal anti-CCR7 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CCR7.

CCR4 Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Human, Monkey, Gorilla, Gibbon
Conjugation Unconjugated
Immunogen CCR4 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Ferret, Elephant, Panda (94%); Dog, Bovine, Bat, Hamster (89%); Mouse, Rat (83%).