Mouse Monoclonal Anti-TrpC7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-TrpC7 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TRPC5
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)HKWGDGQEEQVTTRL, corresponding to amino acid residues 959-973 of human TRPC5. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-TRPM4
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide EKEQSWIPKIFKK(C), corresponding to amino acid residues 5-17 of human TRPM4. Intracellular, N-terminus. |
Rabbit Polyclonal Anti-TRPC7 (extracellular)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DQHVQDDTLHNVS, corresponding to amino acid residues 504-516 of human TRPC7. 2nd extracellular loop. |
Rabbit Polyclonal TRPM2 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to a C-terminal portion of the rat TRPM2 protein (within residues 1430-1508). [Swiss-Prot# Q5G856] |
Rabbit Polyclonal TRPM2 Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the mouse TRPM2 protein (within residues 1200-1300). [Swiss-Prot# Q91YD4] |
Rabbit Polyclonal TRPM8 Antibody
Applications | IHC, WB |
Reactivities | Drosophila, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptides made to residues 278-292 RNQLEKYISERTIQD and the C-terminus sequence NDLKGLLKEIANKIK of the human trp-p8 protein. |
Rabbit Polyclonal Anti-TRPV4 Antibody
Applications | IHC, WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPV4 antibody: synthetic peptide directed towards the middle region of human TRPV4. Synthetic peptide located within the following region: RVDEVNWSHWNQNLGIINEDPGKNETYQYYGFSHTVGRLRRDRWSSVVPR |
Rabbit Polyclonal Anti-TRPC6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the C terminal of human TRPC6. Synthetic peptide located within the following region: GHKKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRS |
TRPC1 (722-733) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Bovine, Canine, Chicken, Equine, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
Immunogen | Synthetic peptide from internal region of human TRPC1 |
TRPM2 (1139-1150) goat polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Monkey |
Immunogen | Synthetic peptide from internal region of human TRPM2 (NP_003298.1) |
Polycystin 2 (PKD2) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 873-903 amino acids from the C-terminal region of human PKD2 |
PKD2L1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 36-65 amino acids from the N-terminal region of human PKD2L1 |
TRPC1 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 764-793 amino acids from the C-terminal region of human TRPC1 |
TRPC4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 811-840 amino acids from the C-terminal region of human TRPC4 |
TRP 7 (TRPC7) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 833-862 amino acids from the C-terminal region of human TRPC7 |
TRPM4 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1120-1149 amino acids from the C-terminal region of human TRPM4 |
TRPV5 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 633-663 amino acids from the C-terminal region of human TRPV5 |
Goat Polyclonal Antibody against TRPC6 (C-terminal)
Applications | WB |
Reactivities | Human |
Immunogen | Peptide with sequence C-EKLSMEPNQEETNR, from the C Terminus of the protein sequence according to NP_004612.2. |
Rabbit Polyclonal TRPV1 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an C-terminal region of the human TRPV1 protein (within residues 725-839). [Swiss-Prot Q8NER1] |
Goat Anti-TRPV3 (aa762-773) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NKIQDSSRNNSK, from the internal region (near C Terminus) of the protein sequence according to NP_659505.1. |
TRPV2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from internal region of human TRPV2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (93%); Marmoset (87%). |
TRPV2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | VRL1 / TRPV2 antibody was raised against synthetic 15 amino acid peptide from internal region of human TRPV2. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Orangutan (93%); Gibbon, Monkey (80%). |
TRPV4 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
Conjugation | Unconjugated |
Immunogen | TRPV4 antibody was raised against synthetic 20 amino acid peptide from internal region of human TRPV4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Panda, Bovine, Dog, Horse, Pig (100%); Elephant, Rabbit (95%); Turkey, Chicken, Platypus (90%); Xenopus (85%); Stickleback, Zebrafish (80%). |
TRPV4 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | TRPV4 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human TRPV4. Percent identity with other species by BLAST analysis: Human (100%); Marmoset (94%); Panda, Dog (89%); Hamster, Bovine, Pig (83%). |
Rabbit Polyclonal Anti-TRPM3 (extracellular)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide KNKDDMPYMSQAQEIHC(C), corresponding to amino acid residues 816-831 of human TRPM3. 1st extracellular loop. |
Rabbit Polyclonal Anti-Human TRPM1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EEKKVKKEKASTETE, corresponding to amino acid residues 1518-1533 of human TRPM1. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-TRPC6 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the middle region of human TRPC6. Synthetic peptide located within the following region: KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVGHNKQPSIRSSE |
Rabbit Polyclonal Anti-TRPC4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPC4 antibody: synthetic peptide directed towards the middle region of human TRPC4. Synthetic peptide located within the following region: CPFKSEKVVVEDTVPIIPKEKHAKEEDSSIDYDLNLPDTVTHEDYVTTRL |
Rabbit Polyclonal Anti-TRPM4 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM4 antibody: synthetic peptide directed towards the N terminal of human TRPM4. Synthetic peptide located within the following region: ELLTVYSSEDGSEEFETIVLKALVKACGSSEASAYLDELRLAVAWNRVDI |
Rabbit Polyclonal Anti-Trpv6 Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Trpv6 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TEIDSSGDDQSLLELIVTTKKREARQILDQTPVKELVSLKWKRYGRPYFC |
Rabbit Polyclonal Anti-TRPC7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TRPC7 antibody is: synthetic peptide directed towards the C-terminal region of Human TRPC7. Synthetic peptide located within the following region: KAQVDRENDEVNEGELKEIKQDISSLRYELLEEKSQATGELADLIQQLSE |
Rabbit Polyclonal Anti-MCOLN1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MCOLN1 antibody: synthetic peptide directed towards the N terminal of human MCOLN1. Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: ALVACKLCKAMAHEASENDMVDDISQELNHNSRDFGQLAVELLDQSYKQD |
Rabbit Polyclonal Anti-TRPM4 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | TRPM4 antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human TRPM4. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (94%); Elephant, Dog, Bat (89%); Marmoset, Mouse, Rat, Hamster, Panda, Bovine (83%). |
Rabbit Polyclonal Anti-TRPM4 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | TRPM4 antibody was raised against synthetic 16 amino acid peptide from internal region of human TRPM4. Percent identity with other species by BLAST analysis: Human, Gorilla, Mouse, Rat, Bovine (100%); Gibbon (94%); Panda, Dog (88%); Elephant (81%). |
Rabbit Polyclonal Anti-TRPA1 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | TRPA1 antibody was raised against synthetic 19 amino acid peptide from internal region of human TRPA1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Marmoset, Bovine (89%); Monkey, Elephant, Dog, Rabbit, Pig (84%). |
Rabbit Polyclonal Anti-TRPA1 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRPA1 antibody was raised against synthetic 18 amino acid peptide from internal region of human TRPA1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset (94%); Dog, Bovine, Elephant (89%); Rat, Bat, Panda, Horse, Rabbit (83%). |
Rabbit Polyclonal Anti-TRPM8 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TRPM8 antibody was raised against synthetic 15 amino acid peptide from internal region of human TRPM8. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Baboon, Monkey, Mouse, Rat, Hamster, Elephant, Panda, Bat, Dog, Rabbit, Horse, Guinea pig, Turkey, Chicken, Armadillo, Platypus (100%); Galago, Marmoset, Bovine, Pig, Opossum, Xenopus (93%); Lizard (87%). |
Rabbit Polyclonal Anti-TRPV1 Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | VR1 / TRPV1 antibody was raised against synthetic 17 amino acid peptide from internal region of human TRPV1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Guinea pig (100%); Monkey (94%); Horse (82%). |
Rabbit Polyclonal Anti-TRPM4 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | TRPM4 antibody was raised against synthetic 17 amino acid peptide from N-Terminus of human TRPM4. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Orangutan, Monkey, Mouse (94%); Gibbon, Galago, Rat, Dog (88%); Marmoset, Elephant, Panda, Bovine, Pig (82%). |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: TPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQKTFTY |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK |
Rabbit Polyclonal Anti-TRPM3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TRPM3 antibody: synthetic peptide directed towards the N terminal of human TRPM3. Synthetic peptide located within the following region: RPYQTMSNPMSKLTVLNSMHSHFILADNGTTGKYGAEVKLRRQLEKHISL |
Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI14C3 (formerly 14C3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI14F1 (formerly 14F1)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRPM4 mouse monoclonal antibody, clone OTI10H5 (formerly 10H5)
Applications | IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRPM8 mouse monoclonal antibody,clone OTI7A11
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TRPV2 mouse monoclonal antibody,clone OTI2G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |