Germany
Japan
United Kingdom
China
Primary Antibodies
Download
Goat Anti-PXR / NR1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EQFAITLKSYIECNR, from the internal region of the protein sequence according to NP_003880.3; NP_071285.1; NP_148934.1. |
Rabbit Polyclonal antibody to NR0B1 (nuclear receptor subfamily 0, group B, member 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 96 and 406 of NR0B1 (Uniprot ID#P51843) |
Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal AhR (Ser36) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AhR around the phosphorylation site of serine 36 (N-P-SP-K-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal GR (Ab-226) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 226/234/246 (L-L-S-P-L). |
Rabbit polyclonal GR (Ser226) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 226 (L-L-SP-P-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-NR1I3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NR1I3. |
Rabbit polyclonal RARA Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This RARA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 322-349 amino acids from the C-terminal region of human RARA. |
Rabbit polyclonal ESRRA Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ESRRA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-159 amino acids from the Central region of human ESRRA. |
Rabbit polyclonal NR1H3 Antibody (Center)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NR1H3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 226-253 amino acids from the Central region of human NR1H3. |
Rabbit Polyclonal AhR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human AhR |
Rabbit anti-THRB Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human THRB |
Rabbit anti-HNF4A Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HNF4A |
Rabbit anti-NR1H3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human NR1H3 |
Rabbit anti-ESR2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ESR2 |
Rabbit anti-PGRMC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PGRMC1 |
Rabbit Polyclonal Anti-NR1H4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: AECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKSCREKT |
Rabbit Polyclonal ERR alpha/NR3B1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an N-terminal portion of human Estrogen Related Receptor alpha (within residues 1-50). [Swiss-Prot# P11474] |
Rabbit Polyclonal Anti-NR1H4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H4 antibody: synthetic peptide directed towards the middle region of human NR1H4. Synthetic peptide located within the following region: SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT |
Rabbit Polyclonal Anti-NR2E3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2E3 antibody: synthetic peptide directed towards the N terminal of human NR2E3. Synthetic peptide located within the following region: METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVC |
Rabbit Polyclonal Anti-NR2E3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR2E3 antibody is: synthetic peptide directed towards the C-terminal region of Human NR2E3. Synthetic peptide located within the following region: EHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELL |
Rabbit Polyclonal Anti-PPARG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: synthetic peptide directed towards the N terminal of human PPARG. Synthetic peptide located within the following region: MGETLGDSPIDPESDSFTDTLSANISQEMTMVDTEMPFWPTNFGISSVDL |
Rabbit Polyclonal Anti-NR2F2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F2 antibody: synthetic peptide directed towards the C terminal of human NR2F2. Synthetic peptide located within the following region: EYSCLKAIVLFTSDACGLSDVAHVESLQEKSQCALEEYVRSQYPNQPTRF |
Rabbit Polyclonal Anti-RXRB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the C terminal of human RXRB. Synthetic peptide located within the following region: AKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAKLLLRLPALRSIG |
Rabbit Polyclonal Anti-NR1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NR1I2 antibody is: synthetic peptide directed towards the N-terminal region of Human NR1I2. Synthetic peptide located within the following region: AELASNHPRGPEANLEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVG |
Rabbit Polyclonal Anti-ZNF335 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNF335 antibody: synthetic peptide directed towards the middle region of human ZNF335. Synthetic peptide located within the following region: EAAAHSAVTAVADAAMAQAQGLFGTDETVPEHIQQLQHQGIEYDVITLAD |
Rabbit Polyclonal Anti-NR1I2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1I2 antibody: synthetic peptide directed towards the N terminal of human NR1I2. Synthetic peptide located within the following region: MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATG |
Rabbit Polyclonal Anti-NR2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR2F1 antibody: synthetic peptide directed towards the C terminal of human NR2F1. Synthetic peptide located within the following region: VLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLP |
Rabbit Polyclonal Anti-NR0B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the N terminal of human NR0B1. Synthetic peptide located within the following region: MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG |
Rabbit Polyclonal Anti-NR0B1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR0B1 antibody: synthetic peptide directed towards the middle region of human NR0B1. Synthetic peptide located within the following region: FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS |
Mouse Monoclonal PPAR gamma (C-terminus) Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Retinoic Acid Receptor beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Retinoic Acid Receptor beta Antibody: A synthesized peptide derived from human Retinoic Acid Receptor beta |
Rabbit Polyclonal Anti-NR4A3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR4A3 Antibody: A synthesized peptide derived from human NR4A3 |
Rabbit Polyclonal Anti-THR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THR1 Antibody: A synthesized peptide derived from human THR1 |
Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma |
Rabbit Polyclonal Anti-Phospho-Retinoic Acid Receptor alpha (Ser77) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-Retinoic Acid Receptor alpha (Ser77) Antibody: A synthesized peptide derived from human Retinoic Acid Receptor alpha around the phosphorylation site of Sersine 77 |
| Modifications | Phospho-specific |
USD 379.00
In Stock
USD 480.00
2 Weeks
Active filters
Families
- Nuclear Hormone Receptor
Filter by
Target Symbol
- PGR (172)
- ESR1 (72)
- NR3C1 (68)
- ESRRA (55)
- NR2E3 (55)
- NR2C2 (52)
- PTGES3 (50)
- RARA (50)
- AR (47)
- NR2C1 (47)
- NR1I3 (46)
- PPARA (45)
- THRA (44)
- NR4A3 (42)
- HNF4A (39)
- ESRRG (38)
- ESRRB (35)
- ESR2 (33)
- RORB (33)
- RORA (27)
- NR1D2 (26)
- PPARD (21)
- NR1H3 (20)
- NR2F6 (17)
- PPARG (15)
- NR0B1 (14)
- AHR (13)
- VDR (13)
- NR4A1 (12)
- THRB (12)
- NR5A2 (11)
- NR1H2 (10)
- NR1H4 (9)
- NR1I2 (9)
- RARG (9)
- RARB (8)
- NR2F2 (7)
- RXRB (7)
- RXRG (7)
- NR2F1 (6)
- NR4A2 (6)
- RXRA (6)
- HNF4G (5)
- NR1D1 (5)
- TRIP4 (5)
- NR2E1 (4)
- PLAAT4 (4)
- MED1 (3)
- NR3C2 (3)
- PGRMC1 (3)
- PGRMC2 (1)
- ZNF335 (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Oocyte meiosis (219)
- Progesterone-mediated oocyte maturation (172)
- Pathways in cancer (161)
- Neuroactive ligand-receptor interaction (124)
- PPAR signaling pathway (121)
- Acute myeloid leukemia (71)
- Adipocytokine signaling pathway (65)
- Maturity onset diabetes of the young (55)
- Prostate cancer (47)
- Thyroid cancer (35)
- Non-small cell lung cancer (28)
- Small cell lung cancer (28)
- Wnt signaling pathway (21)
- Huntington's disease (15)
- MAPK signaling pathway (12)
- Circadian rhythm - mammal (5)