HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI2D5 (formerly 2D5)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-NP Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NP antibody: synthetic peptide directed towards the middle region of human NP. Synthetic peptide located within the following region: GVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFG |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 23 and 218 of HPRT (Uniprot ID#P00492) |
Rabbit Polyclonal antibody to HPRT (hypoxanthine phosphoribosyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 218 of HPRT (Uniprot ID#P00492) |
NM23A (NME1) mouse monoclonal antibody, clone 1D7, Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Rabbit Polyclonal nm23-H1 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
purified NME1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI1A12
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700459 |
purified NME1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4H2
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700459 |
NM23A (NME1) mouse monoclonal antibody, clone 4B2, Ascites
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit anti-ATIC Polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ATIC |
Rabbit anti-HPRT1 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HPRT1 |
Rabbit anti-PNP Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PNP |
Rabbit Polyclonal Anti-HPRT1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HPRT1 antibody: synthetic peptide directed towards the middle region of human HPRT1. Synthetic peptide located within the following region: STGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVK |
Rabbit Polyclonal Anti-GMPS Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GMPS antibody: synthetic peptide directed towards the middle region of human GMPS. Synthetic peptide located within the following region: VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA |
Rabbit Polyclonal Anti-POLD2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLD2 antibody: synthetic peptide directed towards the N terminal of human POLD2. Synthetic peptide located within the following region: LREVSEEHNLLPQPPRSKYIHPDDELVLEDELQRIKLKGTIDVSKLVTGT |
Rabbit Polyclonal Anti-POLR1D Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-POLR1D antibody: synthetic peptide directed towards the middle region of human POLR1D. Synthetic peptide located within the following region: TRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF |
purified NME1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI6E8
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700462 |
purified NME1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI7D6
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700463 |
purified NME1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI22F10
Applications | ELISA, LMNX |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700459 |
HPRT (HPRT1) mouse monoclonal antibody, clone AT2G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
GMP Synthase (GMPS) mouse monoclonal antibody, clone 1D10
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit polyclonal antibody to ATIC (5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 310 and 580 of ATIC (Uniprot ID#P31939) |
Rabbit polyclonal NM23 (NME1) Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NM23 (NME1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 25-54 amino acids from the N-terminal region of human NM23 (NME1). |
HPRT (HPRT1) mouse monoclonal antibody, clone AT2G8, Purified
Applications | ELISA, WB |
Reactivities | Human |
NM23A (NME1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to DNA pol delta cat (polymerase (DNA directed), delta 1, catalytic subunit 125kDa)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 685 and 1071 of DNA pol delta cat (Uniprot ID#P28340) |
Rabbit polyclonal anti-POLD1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human POLD1. |
Anti-POLR1C Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 200 amino acids of human polymerase (RNA) I polypeptide C, 30kDa |
Rabbit Polyclonal Anti-ATIC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the middle region of human ATIC. Synthetic peptide located within the following region: RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYT |
NM23A (NME1) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 87-130 of Human NM23-H2. |
HPRT (HPRT1) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human HPRT1 |
GMP Synthase (GMPS) (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human GMPS |
GMP Synthase (GMPS) (C-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human GMPS |
POLD1 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal NME1 Antibody (C-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NME1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 103-131 amino acids from the C-terminal region of human NME1. |
Rabbit polyclonal NME1 Antibody (Center)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This NME1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-57 amino acids from the Central region of human NME1. |
Mouse monoclonal NME1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal POLD2 Antibody (Center)
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Mouse Monoclonal anti-ATIC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Frog, and Fruit fly |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-POLR1C Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-POLR1C antibody is: synthetic peptide directed towards the N-terminal region of Human POLR1C. Synthetic peptide located within the following region: VRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDA |
Goat Anti-NME1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence DYTSCAQNWIYE, from the C Terminus of the protein sequence according to NP_937818.1; NP_000260.1. |
Rabbit Polyclonal Anti-ATIC Antibody
Applications | WB |
Reactivities | Hamster, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ATIC antibody: synthetic peptide directed towards the N terminal of human ATIC. Synthetic peptide located within the following region: YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKG |
Mouse Monoclonal ATIC Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATIC mouse monoclonal antibody, clone OTI1D2 (formerly 1D2)
Applications | FC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATIC mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ATIC mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | WB |
Reactivities | Human, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HPRT1 mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |